(data stored in ACNUC1104 zone)

EMBL: CP000959.PE436

CP000959.PE436       Location/Qualifiers
FT   CDS_pept        complement(516354..517190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3625"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Transcriptional
FT                   regulator TetR; KEGG: bur:Bcep18194_B2190 transcriptional
FT                   regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3625"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92777"
FT                   /db_xref="GOA:B1K3Q6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015292"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3Q6"
FT                   /protein_id="ACA92777.1"
FT                   /translation="MNEAKKLRRTSAGGYARGDETRQRIIEAAIELFGERGFAGASTRE
FT                   IAAMAGVNAPALQYYFENKEGVYRACVETIAEHGWQVFAPAVGHARAMLDGHASVDALI
FT                   DAFIGLLRALSDRMFTAPKTMNQRMFFAREQGGQEPASASEILMTRMRKPLNDVSAELI
FT                   GRITGRPADDPVTRLRALSLFGQITVFHIAQRSALQLLEWEAFEGERAALVTDTIADQT
FT                   RVLLEQWHAQRDAHASSAESAAKRAQGAAAKRRAAKPGAVPPAAKSTTRVKKPAAR"
     atgaacgaag cgaagaagct gcgccgcacg tcggcgggcg gctacgcgcg cggcgacgag        60
     acgcgccagc ggatcatcga ggcggcgatc gaactgttcg gcgaacgcgg gttcgcgggc       120
     gcgtcgacgc gcgagatcgc cgcgatggcg ggcgtgaacg cgccggcgct ccagtactac       180
     ttcgagaaca aggaaggcgt gtaccgcgcg tgcgtcgaga cgatcgccga gcacggctgg       240
     caagtgttcg cgccggcggt cggccatgcg cgggcgatgc tcgacggcca tgcgagcgtc       300
     gatgcgctga tcgatgcgtt catcgggctg ctgcgtgcgc tgtcggaccg gatgttcacc       360
     gcgccgaaga cgatgaacca gcggatgttc ttcgcgcgcg agcagggcgg ccaggagccg       420
     gcgagcgcga gcgagatcct gatgacgcgc atgcgcaagc cgctgaacga cgtgagcgcg       480
     gaattgatcg gccgcatcac ggggcggccg gccgacgatc ccgtcacgcg gttgcgcgcg       540
     ctgagcctgt tcggacagat cacggtgttc cacatcgcgc agcgttcggc gctgcagttg       600
     ctcgaatggg aggcgttcga gggcgagcgc gcggcgctgg tgaccgacac gattgccgac       660
     cagacgcgcg tgctgctcga gcaatggcat gcgcagcgcg atgcgcatgc ctccagcgcg       720
     gaatccgctg caaagcgggc gcagggtgcc gcggcgaaac gacgtgcggc gaagccgggg       780
     gcggttccgc ccgccgcgaa aagcacgacg cgcgtgaaga agcctgccgc gcgttga          837
//

If you have problems or comments...

PBIL Back to PBIL home page