(data stored in ACNUC1104 zone)

EMBL: CP000959.PE439

CP000959.PE439       Location/Qualifiers
FT   CDS_pept        519999..521486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3628"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bur:Bcep18194_B2193 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3628"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92780"
FT                   /db_xref="GOA:B1K3Q9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3Q9"
FT                   /protein_id="ACA92780.1"
FT                   /translation="MKPFSLPRRPALTLCAAACLLAGCTVGPDYHGAPAAPDASTFVRA
FT                   PATGVDTASPAPSAWWHALNDRQLDALIVAALVYNPDLHAAQARLRAARAQLSQQRAAQ
FT                   MPKSSATVAAIRMREPDVSALGSLLPSNGSEQSGGTSPSLGGSGPLQLYSAGFDATWEI
FT                   DLFGGTRRAVEAASAQAEAVDADLADTQVSIAAEVANAYVDLRDQQQRLALSKRTAQLQ
FT                   QQMLELTQQRRARGVAADADIERLTTQVENTRASLIPLDAQVTESLDRLAILTGRAPGA
FT                   LDAALSTPDAALPTLPGSVAIGDPATLLKQRPDIRAAERRLASSNAQIGEHVADYFPKV
FT                   TLLGDLGFSATDPGHLFRKQNFTWVGAPYLQWNILDFGRTRGAVRAAEASRDEAEANYQ
FT                   KAVLGALQDANTALQRYGHQREHVVALTKVQTSAVHSRALMDQRYRAGVASMIDLLDTQ
FT                   REAFAAQQNVIAGQAELIKNYVSVQKSLGLGWQTSAG"
     atgaaaccct tctccctgcc ccgccgcccc gcgctcaccc tgtgtgcggc cgcgtgcctg        60
     ctcgccggct gcacggtcgg ccccgactac cacggcgcgc ccgccgcacc ggatgcatcg       120
     accttcgtgc gtgcgccggc cactggcgtc gacaccgcgt cgcccgcacc gagcgcgtgg       180
     tggcatgcac tgaacgatcg ccagctcgac gcgctgatcg tcgccgcgct cgtgtacaac       240
     cccgatctgc acgccgcgca ggcccgcttg cgcgcggcac gcgcacagct ctcgcaacag       300
     cgcgccgcgc agatgccgaa atcgtcggcc accgtcgcgg ccatccgcat gcgcgagccg       360
     gacgtcagcg cgctcggctc gctgctgccg tcgaacggct cggagcaatc gggcggcacg       420
     tcgccgtcgc tcggcggctc ggggccgctg caactctatt cggcgggctt cgacgcgacg       480
     tgggaaatcg acctgttcgg cggcacgcgc cgcgcggtcg aagccgcatc cgcccaggcc       540
     gaagcggtcg atgccgatct cgccgacacg caggtgtcga tcgcggccga agtcgcgaat       600
     gcgtatgtcg acctgcgcga ccagcagcaa cgacttgcgt tgtcgaagcg caccgcgcaa       660
     ctgcaacagc agatgctcga actgacgcag cagcgccgcg cgcgcggcgt cgcggccgat       720
     gccgacatcg agcgactgac gacgcaggtc gagaacacgc gcgcgtcgct gatcccgctc       780
     gacgcccagg tgaccgaatc gctcgaccgg ctcgcgatcc tgacgggccg cgcgccgggc       840
     gcgctcgacg ccgcgctgtc gaccccggac gcggcattgc cgacgctgcc cggcagcgtc       900
     gcgatcggcg atccggccac gctgctgaaa cagcgccccg atattcgcgc ggccgaacgc       960
     cggcttgcgt ccagcaatgc gcagatcggc gagcatgtcg ccgactattt tccgaaggtg      1020
     acgttgctcg gcgatctcgg cttcagcgcg acggacccgg gccatctgtt ccgcaagcag      1080
     aatttcacgt gggtcggtgc gccgtacctg caatggaaca ttctcgactt cggacgcacg      1140
     cgtggcgcgg tacgcgcggc agaagcatcg cgcgatgaag cggaggcgaa ttatcagaag      1200
     gccgtgctcg gtgcattaca ggatgccaac accgcgttgc agcgttacgg gcatcagcgc      1260
     gagcacgtcg tcgcattgac gaaggtgcag acgtcggccg ttcattcgcg cgcgctgatg      1320
     gaccagcgct atcgcgcggg cgtcgcgtcg atgatcgacc tgctcgatac gcaacgtgaa      1380
     gcgttcgccg cgcagcagaa cgtgatcgcc gggcaggccg aactgatcaa gaactacgtg      1440
     tcggtgcaga agagcctcgg gctcggctgg cagacgagcg ccggttga                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page