(data stored in ACNUC1104 zone)

EMBL: CP000959.PE441

CP000959.PE441       Location/Qualifiers
FT   CDS_pept        523337..523948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3630"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; KEGG: bur:Bcep18194_B2195 ankyrin
FT                   repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3630"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92782"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3R1"
FT                   /protein_id="ACA92782.1"
FT                   /translation="MRSERFPHTIRAAVAALALAALAGCAHLPDQPTYGKADPAALRRY
FT                   DGDWFDAARVGRVDILRALHDAGYPVDATDSHGYTAVILASYDGQPAALDYLLSVGADA
FT                   CVGDRHGNTALMGALFRNEPDIARRLIDTRCPIDQTNGAGETALGFATLFNRFELIPLL
FT                   VAHGANPNHVDRRGQSLLQLALTHDNTYAADALRNAGAKP"
     atgcgatccg aacgcttccc ccacacgatc cgtgcggccg tggcagcgct cgcgctggcc        60
     gcgctcgccg gctgcgcgca cctgcccgac cagccgacgt acggcaaggc cgaccctgcc       120
     gcgctgcgcc gctatgacgg cgactggttc gacgccgcgc gcgtcggccg cgtcgatatc       180
     ctgcgcgcgt tgcacgatgc cggctatccg gtcgacgcca ccgacagcca cggctatacg       240
     gccgtgattc tcgcgtcgta cgacggccag cccgcggcgc tcgactacct gttgtcggtc       300
     ggcgccgatg cgtgcgtcgg cgatcgtcac ggcaacacgg cgctgatggg cgccctcttc       360
     cggaacgagc ccgacatcgc gcgacgcctg atcgacacgc gctgcccgat cgaccagacg       420
     aacggcgccg gcgaaaccgc gctggggttc gcgacgctgt tcaaccgctt cgagctgatt       480
     ccgctgctcg tcgcgcatgg cgcgaatccg aaccatgtcg accggcgcgg ccagtcgctg       540
     cttcaactcg cgctgacgca cgacaacacg tatgcggcgg acgccctgcg aaatgccggc       600
     gccaaaccgt ag                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page