(data stored in ACNUC1104 zone)

EMBL: CP000959.PE442

CP000959.PE442       Location/Qualifiers
FT   CDS_pept        524353..525513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3631"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bmu:Bmul_4356 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3631"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92783"
FT                   /db_xref="GOA:B1K3R2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3R2"
FT                   /protein_id="ACA92783.1"
FT                   /translation="MKNQKRCCHGAVCALVAAMLAGCGPSEQQAAAPATPVAAMTVAAT
FT                   RVDVTEDLPGRVAAVRVAEIRPQVSGIVQRRLFEQGTEVRAGQPLFQINPAPFKAEMDT
FT                   AAASLQRAQAALERAKVQTARFKPLVEADAISRQVYDDAVSQRDQAAADVAQARATLAR
FT                   RQLDLKFATVEAPIAGRIDQALVTEGALVSSSDSQPMARIQQIDQVYVDVRQPAASLEA
FT                   LRDALASQPQASDGNGLPVDVLRDDDTRYDVRGRMLFSGVNVDPGTGDVLLRVLVDNPK
FT                   RQLLPGMYVRARIPRAHYANAVMVPQQAIVRAGGKPQVWVLDAKGTARLKAVEVGELTN
FT                   RSYRIKSGLQAGQKIVVEGMERLTDGAPAAATDWKSPDAVATASAH"
     atgaagaatc agaaacgatg ctgccacggt gccgtatgcg cgctggtggc ggcaatgctg        60
     gcggggtgcg gaccgtccga gcagcaggcc gccgccccgg ccaccccggt cgcggccatg       120
     acggtggccg ccacgcgcgt cgacgtgacc gaagacctgc cgggccgcgt cgcggccgtg       180
     cgggtggccg agatccggcc gcaggtgagc ggcatcgtgc aacgccggct gttcgaacaa       240
     ggcaccgaag tgcgcgccgg ccagccgctg ttccagatca atccggcgcc gttcaaggcg       300
     gagatggaca cggctgccgc ctcgctgcag cgtgcgcagg ccgcgctcga gcgcgcgaag       360
     gtgcagacgg cgcgcttcaa gccgctcgtc gaggccgacg cgatcagccg ccaggtgtac       420
     gacgacgccg tatcgcaacg cgaccaggcc gcggccgacg tcgcgcaggc ccgcgcgacg       480
     ctcgcgcgcc gccagctcga cctgaagttc gcgaccgtgg aagcgccgat cgccggccgc       540
     atcgaccagg cgctcgtgac cgaaggcgcg ctggtgtcga gcagcgacag ccagccgatg       600
     gcgcgcatcc agcagatcga ccaggtctac gtggacgtgc ggcaaccggc cgcctcgctc       660
     gaggcgctgc gcgacgcgct cgcgtcgcag ccgcaagcgt cggacggcaa cggcctgccg       720
     gtcgacgtgc tgcgcgacga cgacacgcgt tacgacgtgc gcggccgcat gctgttctcg       780
     ggcgtcaacg tcgatccggg caccggcgac gtgctgctgc gcgtgctggt cgacaacccg       840
     aaacgccagt tgctgccggg catgtacgtg cgtgcccgga ttccgcgcgc gcactacgcc       900
     aacgccgtga tggtgccgca acaggccatc gtgcgcgccg gcggcaagcc gcaggtgtgg       960
     gtgctcgacg cgaaaggtac cgctcgtctg aaagcggtcg aggtcggcga actgacgaac      1020
     cgcagctatc ggatcaaatc gggcctgcag gccggtcaga agatcgtcgt cgaaggcatg      1080
     gagcgcctga ccgacggcgc accggctgcc gcaaccgact ggaagtcgcc tgacgcggtc      1140
     gccaccgcgt ccgcgcactg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page