(data stored in ACNUC1104 zone)

EMBL: CP000959.PE452

CP000959.PE452       Location/Qualifiers
FT   CDS_pept        complement(540580..542631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3641"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   1.1 domain protein; sigma-70 region 3 domain protein;
FT                   sigma-70 region 2 domain protein; sigma-70 region 4 domain
FT                   protein; sigma-70 non-essential domain protein; sigma-70
FT                   region 1.2; KEGG: bam:Bamb_3257 RNA polymerase, sigma 70
FT                   subunit, RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3641"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92793"
FT                   /db_xref="GOA:B1K3S2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3S2"
FT                   /protein_id="ACA92793.1"
FT                   /translation="MTKKLNEVSVEDDANQSDEQPAAAAAPGKSKVRDRRAKEKALLKE
FT                   AFATSTPGTAEELEERRVKLRALIKLGKERGFLTYAEINDHLPDNFTETEALEGIIGTF
FT                   NDMGVAVYEQAPDAETLLLNDNAPAASSDDEVEEEAEVALSTVDSEFGRTTDPVRMYMR
FT                   EMGTVELLTREGEIEIAKRIEDGLRHMVMAISACPTTIADILAMAERVANEEIRVDELV
FT                   DGLLDPNASDSADTDGFSAKEAEAIENEDEEAEEEEEEEEEEEDDGAAQASANAAQLEA
FT                   LKRASLEKFSQISEWFDKMRRAFEKEGYKSKAYLKAQETIQSELMTIRFTARTVERLCD
FT                   TLRAQVDEVRQVERQILHIVVDKCGMPRSEFIARFPGSETDLDWAEKITAEGHPYSAVL
FT                   SRNVPAIREQQQRLLDLQARVVLPLKDLKETNRQMAAGELKARQAKREMTEANLRLVIS
FT                   IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQAR
FT                   TIRIPVHMIETINKMNRISRQILQETGLEPDPATLAEKMEMPEDKIRKIMKIAKEPISM
FT                   ETPIGDDDDSHLGDFIEDTNTVAPADAALHASMRDVVKDVLDSLTPREAKVLRMRFGIE
FT                   MSTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSDKLKSFLEGN"
     atgaccaaaa agctgaacga agtatccgtc gaagacgacg caaatcagag cgacgagcag        60
     cccgcagccg cggctgcacc gggcaagtcc aaggtgcgcg atcgtcgcgc caaggaaaag       120
     gcgctgctga aggaagcgtt cgcgacgagc acgccgggca cggccgagga gctcgaagag       180
     cgccgcgtga aactgcgcgc gctgatcaag ctcggcaagg agcgcggctt cctcacgtac       240
     gccgaaatca acgaccacct gccggacaac ttcaccgaga cggaagccct cgagggcatc       300
     atcggcacgt tcaacgacat gggcgtggcg gtttacgagc aggcgccgga cgcggaaacg       360
     ctgctcctga acgacaacgc gcccgccgcg tcgtcggacg atgaagtcga ggaggaagcg       420
     gaagtcgcgc tgtccaccgt cgattcggaa ttcggccgca cgaccgatcc ggtccggatg       480
     tacatgcgcg agatgggcac ggtcgagctg ctcacgcgcg aaggcgaaat cgagatcgcg       540
     aagcggatcg aggacggcct gcgccacatg gtgatggcca tctccgcgtg cccgacgacg       600
     atcgccgaca tcctcgcgat ggccgaacgc gtcgcgaacg aagagatccg cgtcgacgag       660
     ctcgtcgacg gcctgctcga tccgaatgct tcggactccg ccgatacgga cggcttctcc       720
     gcgaaggaag cggaagccat cgagaacgag gacgaggaag ccgaagagga agaggaagaa       780
     gaggaagagg aggaagacga cggtgccgcg caggcatcgg cgaacgccgc ccagctcgaa       840
     gccctcaagc gcgcatcgct cgagaagttc tcgcagatca gcgagtggtt cgacaagatg       900
     cgccgcgcgt tcgagaagga aggctacaag tcgaaggcct acctgaaggc gcaggaaacg       960
     atccagagcg aactgatgac gatccgcttc accgcgcgta ccgtcgaacg cctgtgcgac      1020
     acgctgcgcg cgcaggtgga cgaagtgcgt caggtcgagc gtcagatcct gcacatcgtc      1080
     gtcgacaagt gcggcatgcc gcgctcggaa ttcatcgcgc gcttcccggg cagcgagacg      1140
     gatctcgact gggccgagaa gatcaccgcg gaaggccatc cgtacagcgc ggtgctgtcg      1200
     cgtaacgtcc cggcgatccg cgaacagcag cagcgcctgc tcgacctgca ggcgcgcgtc      1260
     gtgctgccgc tgaaggacct gaaggaaacc aaccgccaga tggcggccgg cgaactgaag      1320
     gcgcgtcagg cgaagcgcga aatgaccgag gccaacctgc gtctcgtgat ctcgatcgcg      1380
     aagaagtaca cgaaccgcgg cctgcagttc ctcgacctga tccaggaagg caacatcggc      1440
     ctgatgaagg cggtggacaa gttcgaatac cgtcgcggct acaagttctc gacctatgcg      1500
     acgtggtgga tccgtcaggc catcacgcgt tcgatcgccg accaggcgcg cacgatccgt      1560
     attccggttc acatgatcga aacgatcaac aagatgaacc gcatctcgcg gcagatcctg      1620
     caggaaaccg gtctcgagcc ggacccggca acgctcgccg agaagatgga gatgccggaa      1680
     gacaagatcc gcaagatcat gaagatcgcg aaggagccga tctcgatgga aacgccgatc      1740
     ggtgacgacg acgattccca tctcggcgac ttcatcgagg acaccaacac ggtcgcgccg      1800
     gcggatgccg cgctgcatgc cagcatgcgc gacgtcgtga aggacgtgct cgattcgctg      1860
     acgccgcgcg aggcgaaggt gctgcggatg cgtttcggta tcgagatgag caccgatcac      1920
     acgctcgagg aagtcggcaa gcagttcgac gtcacgcgcg agcggatccg tcagatcgag      1980
     gccaaggcgc tgcgcaagct gcgtcacccg agccgttccg acaagctgaa gtcgttcctc      2040
     gaagggaact ga                                                          2052
//

If you have problems or comments...

PBIL Back to PBIL home page