(data stored in ACNUC1104 zone)

EMBL: CP000959.PE453

CP000959.PE453       Location/Qualifiers
FT   CDS_pept        complement(543086..544963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3642"
FT                   /product="DNA primase"
FT                   /note="KEGG: bur:Bcep18194_B2205 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: zinc finger CHC2-family protein; TOPRIM
FT                   domain protein; DNA primase DnaG DnaB-binding; DNA primase
FT                   catalytic core domain; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3642"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92794"
FT                   /db_xref="GOA:B1K3S3"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3S3"
FT                   /protein_id="ACA92794.1"
FT                   /translation="MIPHSFLQDLLNRVDIVDVVGRYVQLKKGGANFMGLCPFHNEKSP
FT                   SFTVSPTKQFYHCFGCGAHGTAIGFLMEHAGLTFPEAVQELAQSVGLTVPHEPSMRGGG
FT                   GGGGGGGDYPAPVSKSVATALSDAMTAACDYYRKQLRGATVAIQYLKNRGLTGEIAARF
FT                   GLGYAPDGWQNLEAAFPDYRDESLVEAGLVIVSEKTDAQGVARRYDRFRERIMFPIRNV
FT                   KGQVIGFGGRVLGSGEPKYLNSPETPLFNKGSELYGLFEARLAIRERKYVLVVEGYMDV
FT                   VALAQLGFPNAVATLGTACTPIHVQKLLRQTDTVIFSFDGDSAGRRAARRALEACLPHA
FT                   GDNRTIRFLFLPTEHDPDSYVREFGAEAFSEQVERAMPLSQFLLNEAIAGKALDQPEGR
FT                   AKALFDAKPLLQALPANALRAQIMHMFADRLDIPFEEVAALSDVDTRIATPPRQAPARS
FT                   ERRRVTDSEKRALRTLVMHPRIASQLDDEQIATLRALPRIGELFAEVVDHARALGDGAE
FT                   FRLLSDVLRTSSNGATYEEIFREILDYDENVRDLLLQNPEDETVPERQREQERIAGEEL
FT                   QAAVLKMRYDACCDRLDRLARQSTFTPEELAELTELNQQRTDMKRRLGL"
     gtgattccgc attcgttcct gcaggatttg ctgaaccgcg tcgatatcgt cgacgtggtg        60
     ggccggtacg tgcagctcaa gaagggcggc gccaacttca tggggctgtg cccgttccat       120
     aacgagaaga gcccgtcgtt taccgtgagc ccgaccaagc agttctatca ctgcttcggt       180
     tgcggcgcgc acggcaccgc gatcggcttc ctgatggagc atgcggggct cacgttcccc       240
     gaagccgtgc aggaactcgc gcaatccgtc gggctgaccg tgccgcacga accgtcgatg       300
     cgcggcggcg gtgggggcgg aggcggtggc ggcgactatc cggcgcccgt gtcgaaatcg       360
     gtggcgaccg cgctgtccga tgcgatgacg gcggcctgcg actactaccg caagcagttg       420
     cgcggcgcga ccgtcgcgat ccagtacctg aagaaccggg gcctgaccgg cgagatcgcc       480
     gcacgcttcg gtcttggcta tgcgccggac ggctggcaga acctcgaggc cgcgttcccg       540
     gactatcgcg acgagtcgct cgtcgaggcg gggctcgtga tcgtcagcga gaaaaccgac       600
     gcccagggcg tcgcgcgccg ctacgaccgg ttccgcgagc ggatcatgtt cccgatccgc       660
     aacgtgaagg ggcaggtgat cggtttcggc ggccgcgtgc tcggcagcgg cgaaccgaag       720
     tacctgaatt cgcctgaaac gccgttgttc aacaagggca gcgagctgta cgggctgttc       780
     gaggcgcggc tcgcgattcg cgagcgcaag tacgtgctgg tcgtcgaagg ctacatggac       840
     gtcgtcgcgc tcgcgcagct cgggtttccg aacgcggtcg cgacgctcgg caccgcatgc       900
     acgccgattc acgtgcagaa gctgctgcgc cagaccgaca cggtcatttt cagtttcgac       960
     ggcgattcgg ccgggcggcg cgcggcccgg cgcgcgctcg aggcctgcct gccgcatgcg      1020
     ggcgacaacc gcacgatccg gttccttttt ctgccgaccg agcacgatcc ggacagctac      1080
     gtgcgcgaat tcggcgcgga ggcgttctcc gagcaggtcg aacgcgcgat gccgctgtcg      1140
     caatttctgt tgaacgaagc gattgccggc aaggcgctcg atcagccgga aggccgcgcg      1200
     aaggcgctct tcgatgcgaa gccgctgttg caggcgctgc ccgcgaacgc gttgcgcgcg      1260
     cagatcatgc acatgttcgc cgaccgtctc gacatcccgt tcgaagaggt cgcggcgctg      1320
     tcggacgtcg atacgcgcat cgcgacgccg ccgcgccagg cgcccgcgcg cagcgagcgg      1380
     cgccgcgtga cggacagcga aaagcgcgcg ttgcgtacgc tggtgatgca tccgcgcatc      1440
     gcatcgcagc ttgacgacga acagattgcg accctgcgcg cgctgccgcg catcggcgag      1500
     ctgttcgcgg aagtcgtcga tcatgcgcgc gcgctgggcg acggcgcgga gttccggctg      1560
     ctgtcggatg tcctcaggac gtcctcgaac ggggcgactt acgaggaaat cttccgcgaa      1620
     attctggact atgatgaaaa cgtccgcgat ttgctgttac agaatccgga agacgagacg      1680
     gtgcccgagc ggcagcgtga gcaggagagg atcgcggggg aggagctgca ggcagcggtg      1740
     ctcaagatgc gctatgacgc ctgctgcgac cggctggaca ggctggcgcg gcaatccacc      1800
     ttcacccccg aggaactggc cgaattgacg gaattgaacc agcagcgaac cgacatgaag      1860
     cgtcggctcg ggctgtag                                                    1878
//

If you have problems or comments...

PBIL Back to PBIL home page