(data stored in ACNUC1104 zone)

EMBL: CP000959.PE461

CP000959.PE461       Location/Qualifiers
FT   CDS_pept        complement(552310..552603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3650"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /note="TIGRFAM: exodeoxyribonuclease VII, small subunit;
FT                   PFAM: Exonuclease VII small subunit; KEGG:
FT                   bur:Bcep18194_B2213 exodeoxyribonuclease VII small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3650"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92802"
FT                   /db_xref="GOA:B1K3T1"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1K3T1"
FT                   /protein_id="ACA92802.1"
FT                   /translation="MAKTASPGATPPGNGTEPLPDNYEMALAELETLVARMEGGALSLE
FT                   DSLAAYRRGATLVAFCQQQLEKVEQQVRVLDGATLKPLSSGTAATDGEDDDL"
     atggcgaaaa ccgcatcccc aggcgccacg ccgcccggca atggcaccga accgttgccg        60
     gacaattacg agatggcgct cgcggaactc gagacgctgg ttgcccggat ggaaggcggc       120
     gcgttgagcc tcgaggattc actggcggcg tatcgccgcg gtgcgaccct cgttgcgttt       180
     tgccaacagc agctcgagaa agtggagcag caggttcgcg tgctcgacgg cgcgacgctg       240
     aagccgcttt cgtccggaac ggccgccacg gacggcgaag acgacgatct atga             294
//

If you have problems or comments...

PBIL Back to PBIL home page