(data stored in ACNUC1104 zone)

EMBL: CP000959.PE463

CP000959.PE463       Location/Qualifiers
FT   CDS_pept        554097..554966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3652"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG:
FT                   bur:Bcep18194_B2215 3-mercaptopyruvate sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3652"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92804"
FT                   /db_xref="GOA:B1K3T3"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3T3"
FT                   /protein_id="ACA92804.1"
FT                   /translation="MPHTHYTTLISAANLAERLAAAPGSVALFDCRFDLADPGAGEAAY
FT                   AAGHLPGAQYLHLDRDLSGRKTGTNGRHPLPTRDALATLLASRGLKQGQQVVAYDAQGG
FT                   AYAARLWWLLRWLGHDSVAVLDGGLQAWEAAGQPLTTDVPQPVAGDFRSATPLESTVDA
FT                   AAVLANVSSPARVVIDARAPDRYRGENETIDRVGGHIPGARNRFFKDNLAADGRFKTGH
FT                   ELREAFATVLAGTEPNRVILQCGSGVTACHNALALEVAGLHGASLYPGSWSEWSADPSR
FT                   PIATGPNP"
     atgccacaca ctcattacac cacgctcatt tccgccgcca atctcgccga gcgcctggcc        60
     gcggcgcccg gcagcgtggc attgttcgac tgccgcttcg atctcgccga tcccggcgcc       120
     ggcgaagccg cgtacgcggc cggccacctc cccggcgcgc aatatcttca tctcgaccgc       180
     gacctgtcgg gccgcaagac gggcaccaac ggccgccatc cgctaccgac ccgcgacgcg       240
     ctcgcgacgc tgctcgccag ccgcggcctc aagcagggcc agcaggtcgt cgcgtacgac       300
     gcgcaaggcg gcgcctatgc ggcacgcctg tggtggctgt tgcgctggct cggtcacgat       360
     tcggttgcgg tgctcgacgg cggcctgcag gcctgggaag cggccggcca gccgctgacg       420
     accgacgtgc cgcaaccggt cgccggcgac ttccgctcgg ccacgccgct cgaatcgacg       480
     gtcgatgcag cggccgtgct cgcgaacgtg tcgtcgcctg cgcgcgtcgt gatcgatgca       540
     cgcgcaccgg accgctatcg cggcgagaat gaaacgatcg atcgggtggg cggccacatt       600
     cccggtgcgc gcaaccgctt cttcaaggac aacctggctg ccgacggccg cttcaagacc       660
     ggccatgaat tgcgcgaggc attcgccacc gtgctggccg gcaccgagcc gaatcgcgtg       720
     atcctgcaat gcggctccgg cgtcaccgcc tgccacaacg cgctggcgct ggaagtggcg       780
     ggcctgcacg gcgcgtcgct gtaccccggc tcgtggagcg aatggagcgc cgatccgtcg       840
     cgaccgatcg cgaccggccc gaatccttga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page