(data stored in ACNUC1104 zone)

EMBL: CP000959.PE466

CP000959.PE466       Location/Qualifiers
FT   CDS_pept        complement(557910..560663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3655"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bur:Bcep18194_B2218 DNA polymerase I; TIGRFAM:
FT                   DNA polymerase I; PFAM: DNA-directed DNA polymerase; 5'-3'
FT                   exonuclease; 3'-5' exonuclease; SMART: Helix-hairpin-helix
FT                   domain protein class 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3655"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92807"
FT                   /db_xref="GOA:B1K3T6"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3T6"
FT                   /protein_id="ACA92807.1"
FT                   /translation="MPEERNLEGKTLLLVDGSSYLYRAYHAMPDLRGPGGEPTGALYGI
FT                   INMLRRMRKEVSAEYSACVFDAKGKTFRDDLYADYKANRPSMPPDLALQVEPIHGAVRA
FT                   LGWPLLMVEGVEADDVIGTLAREAERHGMNVIVSTGDKDLAQLVTERVTLVNTMTNETL
FT                   DRDGVIAKFGVPPERIIDYLALIGDTVDNVPGVEKCGPKTAVKWLTQYDTLDGVIEHAA
FT                   DIKGVVGDNLRRALDFLPLGRQLVTVDTSCDLTPHLESIEASLKSDGEARDLLRDIFAR
FT                   YGFKTWLREVDSAPAEGGGADAPEGEPAPVIAADVVREYDTIQTWEQFDAWFAKIDAAA
FT                   LTAFDTETTALDPMLARLVGLSFSVEPGKAAYLPVAHRGPDMPEQLPLDEVLARLKPWL
FT                   ESADRKKVGQHLKYDAQVLANYDIALNGIEHDTLLESYVVESHRTHDMDSLALRHLGVK
FT                   TIKYEDVAGKGAKQIGFDEVALAQAAEYAAEDADITLQLHHALYPQVAREPGLERVYRE
FT                   IEMPVSLVLRKMERTGVLIDDARLHAQSTEIATRLIELEGEAYELAGGEFNLGSPKQIG
FT                   QIFFEKLQLPVVKKTPSGAPSTDEEVLQKLAEDYPLPKLLLEHRGLSKLKSTYTDKLPR
FT                   MVNPTTGRVHTNYAQAVAVTGRLASNDPNLQNIPVRTAEGRRIREAFIASPGHRIVSAD
FT                   YSQIELRIMAHISGDASLLRAFSQGEDIHRATAAEVFGVTPLEVNSDQRRIAKVINFGL
FT                   IYGMSAFGLASNLGITRDAAKLYIDRYFARYPGVAQYMEDTRATAKEKGYVETVFGRRL
FT                   WLPEINGGNGPRRQAAERAAINAPMQGTAADLIKLSMIAVDGWLTRDQLASRMIMQVHD
FT                   ELVLEVPEGELSLVREKLPEMMCGVAKLKVPLVAEVGAGANWEEAH"
     atgcctgaag aacgaaatct ggaaggtaag accctgctat tggttgacgg ttcgagctat        60
     ctgtatcggg cttaccatgc gatgcctgat ttgcgtggcc ctggcgggga gccgaccgga       120
     gcgctctacg gaatcatcaa catgctgcgc cgtatgcgca aggaagtcag tgcagagtat       180
     agcgcttgcg tgttcgatgc aaagggcaag acgttccgcg acgaccttta tgccgactat       240
     aaggcaaacc gtccgtcgat gccgcccgat ctcgccttgc aggtcgagcc gatccacggc       300
     gccgtgcgcg cgctcggctg gccgctgctg atggtcgagg gcgtcgaggc cgacgacgtg       360
     atcggcacgc tcgcgcgcga agccgaacgg cacgggatga acgtgatcgt gtcgaccggc       420
     gacaaggatc tcgcgcagct cgtgaccgag cgcgtcacgc tcgtcaacac gatgaccaac       480
     gagacgctcg accgcgacgg cgtgatcgcg aagttcggtg tgccgcccga gcgcatcatc       540
     gactatctcg cgctgatcgg cgacaccgtc gacaacgtgc cgggcgtcga gaagtgcggg       600
     ccgaagacgg ccgtgaaatg gctgacgcaa tacgacaccc tcgacggcgt gatcgaacac       660
     gcggccgaca tcaagggcgt ggtcggcgac aacctgcgcc gcgcgctcga tttcctgccg       720
     ctcggccgcc agctcgtgac cgtcgatacg tcgtgcgatc tcacgccgca tctcgaatcg       780
     atcgaagcct cgctcaagag cgacggcgag gcgcgcgacc tgctgcgcga catcttcgcg       840
     cgctacggct tcaagacctg gctgcgcgaa gtcgacagcg cgcccgcgga aggtgggggc       900
     gccgatgcgc cggaaggcga gccggccccg gtgatcgcag ccgacgtcgt gcgcgaatac       960
     gacacgatcc agacttggga acagttcgac gcgtggttcg cgaagatcga cgcggccgcg      1020
     ctgaccgcgt tcgacaccga gaccaccgcg ctcgatccga tgctcgcgcg gctcgtcggc      1080
     ctgtcgttct cggtcgagcc gggcaaggcg gcctacctgc cggtcgcgca ccgcggcccc      1140
     gacatgcccg agcagcttcc gctcgacgaa gtgctcgcgc gcctgaagcc gtggctcgaa      1200
     tcggccgatc gcaagaaggt cggccagcac ctgaagtacg acgcgcaggt gctcgcgaac      1260
     tacgacatcg cgctgaacgg catcgagcac gacacgctgc tcgaatcgta cgtggtcgaa      1320
     tcgcaccgca cacacgacat ggacagcctc gcgctgcgtc atctgggcgt caagacgatc      1380
     aagtacgagg acgtggcggg caagggcgcg aagcagatcg gtttcgacga agtggcgctc      1440
     gcgcaggccg ccgaatacgc agccgaagat gccgacatca cgctgcagct tcatcacgcg      1500
     ctgtatccgc aggtcgcacg cgagccgggc ctcgagcgcg tgtaccgcga gatcgagatg      1560
     ccggtgtcgc tcgtgctgcg caagatggag cgcacgggcg tgctgatcga cgatgcgcgt      1620
     ctgcacgcgc agagcaccga aattgcgacg cgcctgatcg agctcgaggg cgaggcgtac      1680
     gaactggcgg gcggcgaatt caatctcggc tcgccgaagc agatcgggca gatcttcttc      1740
     gagaagctgc agttgccggt cgtgaagaag acgccgagcg gcgcgccgtc gaccgacgag      1800
     gaagtgctgc agaagctggc cgaggactac ccgctgccga agctgctgct cgagcatcgc      1860
     gggttgtcga agctgaagtc gacctatacc gacaagctgc cgcgcatggt gaaccccacc      1920
     accggccgcg tgcacacgaa ctatgcgcaa gcggtcgcgg tcacgggccg ccttgcgtcg      1980
     aacgacccca atcttcagaa cattccggtg cgcacggccg aagggcggcg catccgcgag      2040
     gcgttcatcg cgtcgccggg ccaccggatc gtgtcggccg actattcgca gatcgaactg      2100
     cggatcatgg cgcacatctc gggcgacgcg tcgctgctgc gcgcgttctc gcagggcgag      2160
     gacatccacc gcgcgactgc cgccgaggtg ttcggcgtga cgccgctgga ggtcaattcc      2220
     gaccagcgcc ggatcgcgaa ggtaatcaac ttcgggctca tctacgggat gagcgcattc      2280
     gggctcgcat cgaatctcgg catcacgcgc gacgcggcga agctctatat cgaccgctat      2340
     ttcgcccgct atccgggcgt cgcgcagtac atggaagata cgcgcgcgac ggcgaaggag      2400
     aagggctacg tcgaaaccgt tttcggccgc cgtctctggc tgccagagat caacggcggt      2460
     aacggcccgc gccgccaggc ggccgagcgt gcggccatca atgcaccgat gcagggcacg      2520
     gcggccgacc tgatcaagct gtcgatgatc gcggtggacg gctggctcac gcgcgaccag      2580
     ctcgcatcgc gaatgatcat gcaggtgcac gatgaactgg tgctcgaggt gcccgaaggc      2640
     gagctatcgc tcgtgcgcga gaaactgccg gaaatgatgt gcggcgtcgc gaagctgaag      2700
     gtgccgctgg tcgccgaagt gggtgccggc gcgaactggg aagaggcaca ctga            2754
//

If you have problems or comments...

PBIL Back to PBIL home page