(data stored in ACNUC1104 zone)

EMBL: CP000959.PE467

CP000959.PE467       Location/Qualifiers
FT   CDS_pept        560665..561423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3656"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bur:Bcep18194_B2219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3656"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92808"
FT                   /db_xref="GOA:B1K3T7"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3T7"
FT                   /protein_id="ACA92808.1"
FT                   /translation="MNKRKVIPSLRSLADQERATAKKARASWQMFTIMAEFIEATEYLS
FT                   EIRPAVSIYGSARLKPDTPHYKLAVQIARKLSDAGFAVISGGGPGIMEAANKGAHAGKA
FT                   PSVGLNIELPHEQAGNHYQDISLRFRHFFTRKVTFVKNSDAVIVMPGGFGTLDELSEVL
FT                   TLIQTKKSRLVPIILVGSEFWQGLLQWFRDQLIPMGLINPEDMDLMQVIDDPDQVLDAV
FT                   LAFYEDSGEEEGSDEDDHPPRPEEDRMFYL"
     atgaacaaga gaaaagtgat tccgagtctg cgttcgctcg cagatcaaga gcgcgcgacg        60
     gccaagaagg cgcgcgcatc gtggcagatg ttcacgatta tggcagagtt tatcgaggcg       120
     accgagtacc tgtcggagat ccgcccggct gtcagcatct acggttctgc ccgcctcaaa       180
     cccgacacgc cgcactacaa gctggccgtg cagatcgcac gcaagctgtc ggacgccggc       240
     ttcgcggtga tctccggcgg cggccccggc atcatggaag ccgcgaacaa gggcgcgcac       300
     gccggcaagg cgccgtcggt cggcctgaac atcgagctgc cgcacgagca ggccggcaac       360
     cactaccagg acatctcgct gcgcttccgc cacttcttca cgcgcaaggt aacgttcgtg       420
     aagaactcgg atgcggtgat cgtgatgccg ggcggcttcg gcacgctcga cgaactgtcc       480
     gaagtactca cgctgatcca gacgaagaaa tcgcgcctcg tgccgatcat cctcgtcggc       540
     agcgagttct ggcaggggct gctgcaatgg ttccgcgatc aactgattcc gatgggcctg       600
     atcaatccgg aagacatgga tctgatgcag gtgatcgacg atcccgacca ggtgctcgac       660
     gcggtgctcg cgttctacga ggacagcggc gaggaagaag gttcggacga ggacgatcat       720
     ccgccgcgcc cggaagaaga ccggatgttc tatctgtaa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page