(data stored in ACNUC1104 zone)

EMBL: CP000959.PE470

CP000959.PE470       Location/Qualifiers
FT   CDS_pept        563871..564266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3659"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3659"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92811"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3U0"
FT                   /protein_id="ACA92811.1"
FT                   /translation="MKPLIFVAAAVAFAAASVAHAAGGTPDADAQARAEANEAAGLPDL
FT                   RKINRPGAEVTSKVDFADIRRTPSFHEKSKNGTEVTEYRDRGKPVEIDVKSNFGTRYQM
FT                   SSTPDTSPKPHDAGIPITRLPSLNLRY"
     atgaagccgc tcattttcgt cgccgctgcc gtcgcgtttg ccgccgccag cgtcgctcac        60
     gccgccggcg gcacgcctga cgccgacgcg caggcccggg ccgaggccaa cgaagccgcc       120
     ggcctgcccg atctccgcaa gatcaaccgg ccgggcgccg aagtcacgtc gaaagtggac       180
     ttcgccgata tccgccgcac gccgagcttc cacgaaaaga gcaagaacgg caccgaagtc       240
     accgagtacc gcgaccgcgg caagccggtc gagatcgacg tgaagtcgaa cttcggcacg       300
     cgctaccaga tgagctccac gcccgacacg tcgccgaagc cgcatgacgc gggcatcccg       360
     atcacgcgcc tgccgtcgct gaacctgcgc tactga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page