(data stored in ACNUC1104 zone)

EMBL: CP000959.PE473

CP000959.PE473       Location/Qualifiers
FT   CDS_pept        566353..566805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3662"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG:
FT                   bur:Bcep18194_B2231 transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3662"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92814"
FT                   /db_xref="GOA:B1K3U3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K3U3"
FT                   /protein_id="ACA92814.1"
FT                   /translation="MDRLPPLPQTLDEQLCFALYSTSHAMTKAYKPLLDKLSLTYPQYL
FT                   AMLVLWERDDMAVKDIAARLDLDPATVTPLLKRLEALGYVERVRSAADERVVNVRVTPE
FT                   GRALKDRARSVPADLFCAMQQTPEFLIRLRADLQQLRDALSVANER"
     atggaccgcc tgcctccgct gccccagacg ctcgacgagc aactgtgctt cgcgctttat        60
     tcgacttcgc acgcgatgac gaaggcgtac aagcccctgc tcgacaagct gtcgctgacc       120
     tatccccaat atctcgcgat gctcgtgctg tgggagcgcg acgacatggc cgtgaaggac       180
     atcgccgcgc ggctcgacct cgacccggcc acggtcacgc cgctgctcaa gcggctggaa       240
     gcgctcggct acgtggagcg cgtacgcagc gcggccgacg aacgcgtcgt caacgttcgc       300
     gtgacgccgg aaggccgggc gctgaaggat cgcgcgcgct cggtgcccgc cgacctcttt       360
     tgcgcgatgc aacagacacc cgaattcctg atcaggctgc gcgccgatct ccagcagctg       420
     cgcgatgcgc tgtcggtggc caacgaacgc tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page