(data stored in ACNUC1104 zone)

EMBL: CP000959.PE478

CP000959.PE478       Location/Qualifiers
FT   CDS_pept        569937..570731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3667"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: bur:Bcep18194_B2236
FT                   molybdenum ABC transporter, periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3667"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92819"
FT                   /db_xref="GOA:B1K4A1"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4A1"
FT                   /protein_id="ACA92819.1"
FT                   /translation="MRSTVRPLRRTLLRLLPIVTLAAGFTFSAPASAADELVVSAAASL
FT                   TNAFKAVGDAYEKQHPDTKVLFNFGASDVLMQQIAKGAPADVFASADQKAMDRAVNEKV
FT                   IVPGTRRDFAANSLVLIVPADSRAAAPTSLNDLTAPGVKRIAYGDPASVPVGRYTEGAL
FT                   RAAGVWDAVSAKGVLAANVRQSLDYVARGEVDAGFVFGTDAAIMPGRVKVALTVPTQTV
FT                   ITYPIAVVKDSRHAAQAQSFIDFVASPQGQAVLSTFGFKPAK"
     atgcgctcaa ccgtccgtcc gcttcgccgc accctgcttc gcctgctgcc gatcgtcacg        60
     cttgccgccg ggttcacgtt cagcgcgccc gcttccgccg ccgacgaact ggtcgtgtcg       120
     gccgccgcca gcctgacgaa cgcattcaag gccgtcggcg acgcgtacga gaagcagcac       180
     ccggacacca aggtgctgtt caacttcggc gcatcggacg tgctgatgca gcagatcgcc       240
     aagggcgcgc cggccgacgt gttcgcgtcg gccgaccaga aggcgatgga tcgcgcggtg       300
     aacgaaaagg tgatcgtgcc tggcacgcgc cgcgatttcg ccgcgaactc gctggtgctg       360
     atcgtgccgg cggacagccg cgcggccgcg ccgacgtcgc tgaacgacct gaccgcgccc       420
     ggcgtgaagc gcatcgcgta cggcgacccg gcctcggtgc cggtcggccg ctacaccgag       480
     ggtgcgctgc gcgcggccgg cgtgtgggac gccgtcagcg cgaagggcgt gctggccgcc       540
     aacgtgcgcc agagcctcga ctacgtcgcg cgcggcgagg tcgacgcggg cttcgtgttc       600
     ggcaccgacg ccgcgatcat gccgggccgc gtgaaggtcg cgctgacggt gccgacgcag       660
     acggtcatca cctacccgat cgccgtggtc aaggacagcc gccacgccgc gcaggcgcag       720
     tcgttcatcg atttcgtcgc gtcgccgcag ggccaggccg tgctgtcgac gttcggcttc       780
     aagcccgcca agtga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page