(data stored in ACNUC1104 zone)

EMBL: CP000959.PE480

CP000959.PE480       Location/Qualifiers
FT   CDS_pept        571484..572185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3669"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_B2238 ABC molybdate transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3669"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92821"
FT                   /db_xref="GOA:B1K4A3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4A3"
FT                   /protein_id="ACA92821.1"
FT                   /translation="MSLVVDIRKTYASAERRFTLDMSFTATTQRVVLFGPSGAGKSMTL
FT                   QAIAGLLTPDAGTITLNGEPLFDAARRIDVPTRERRVAYLFQDYALFPHLNVRQNIAFG
FT                   LTSGLRNPRAKTVPPEVAYWLRAFDLESLAGQYPSQLSGGQKQRVALARALVAQPRILL
FT                   LDEPFAALDGAMRQRMRHELAELQARLDIPMVLISHDPDDVAAFGDQVVQLSEGRVQAS
FT                   PPHAEWPTRVT"
     atgagcctcg tcgtcgacat ccgcaagacc tacgcgagcg ccgagcgccg cttcacgctc        60
     gacatgtcgt tcacggcgac gacgcagcgc gtcgtgctgt tcgggccgtc gggcgcgggc       120
     aagagcatga cgctgcaggc gatcgcgggg ctgctgacgc ccgacgcagg cacgatcacg       180
     ctgaacggcg agccgctgtt cgacgccgcg cgccggatcg acgtgccgac ccgcgaacgc       240
     cgtgtcgcgt acctgttcca ggactacgcg ctgttcccgc atctgaacgt gcggcagaac       300
     atcgcgttcg ggctcacgtc cgggctgcgc aacccgcgcg cgaagacggt gccaccggag       360
     gtcgcgtact ggctgcgcgc attcgacctc gaatcgctcg cggggcaata tccgtcgcaa       420
     ctgtcgggcg ggcagaagca gcgcgtggca ctcgctcgtg cgctggtcgc gcagccgcgc       480
     atcctgctgc tcgacgaacc cttcgcggcg ctcgacggcg cgatgcgcca gcgcatgcgc       540
     catgagctcg ccgaactgca ggcgcggctc gacatcccga tggtgctgat ctcgcacgac       600
     ccagacgacg tcgccgcgtt cggcgaccag gtcgtgcagt tgagcgaagg acgcgtgcag       660
     gcgagcccgc cgcacgccga gtggccgacg cgcgtcacct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page