(data stored in ACNUC1104 zone)

EMBL: CP000959.PE482

CP000959.PE482       Location/Qualifiers
FT   CDS_pept        complement(573236..574858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3671"
FT                   /product="CHAD domain containing protein"
FT                   /note="PFAM: CHAD domain containing protein; KEGG:
FT                   bur:Bcep18194_B2240 conserved hypothetical protein, CHAD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3671"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92823"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4A5"
FT                   /protein_id="ACA92823.1"
FT                   /translation="MSRVLEIVLSLSLEGWPVKGASRARGAQRDFGAELVRAWRICPQV
FT                   RMRRGHERVTVEPCQIEEAERSPGASWWTWVESNAHGTRVVASRTRTFAPGVTQRELFD
FT                   AEHAGIVVATPLPVPATAGAADTDAPPAAETDGVAPDTDEARAQASALRLVSERRRGRW
FT                   ADDSGVVVEMTLDDITLHGGGEPPRRHVELRLAAPDWETVAARTAALHALFAAARELSG
FT                   AWPAFVQLTSVIDRACAGGPVAATLVKAQPVDLTGIRTQRAALFALSGDITAQWLGNEC
FT                   GVLDRDDPEFVHQMRVALRRLRTLMRFFPRFTDRQWRDTLGVDLRWLAKLLGTVRDWDV
FT                   FATESLPALIAADGGSSDWDGTLDAARAQSMAARVELRQALHSARYARLTLGWLEWLSA
FT                   LALPAADGDDAPSLRRHATKRVRRLFGHLYGSPSLTSLDTAARHQVRIDAKRLRYALEF
FT                   FASLASRRTRTETVKTLARVQSVLGEANDAMVALRHLEQLAAPPYQLGFVRGYGAALEQ
FT                   RAARDAETLLASLRPPKLDGKPG"
     atgtcgcgtg tgctggaaat cgtgttgtcg ttgtcgctgg aaggatggcc ggtcaagggc        60
     gcaagccgtg cccgtggcgc gcaacgcgac ttcggcgccg agctcgtgcg cgcgtggcgg       120
     atctgcccgc aggtccggat gcggcgcggc cacgagcgcg tgacggtcga gccgtgccag       180
     atcgaggagg ccgagcggag ccccggcgcg agctggtgga cctgggtcga atcgaacgcg       240
     catggcacgc gggtcgtcgc atcgcgcacc cggacgttcg cccccggcgt cacgcagcgc       300
     gaactgttcg acgcggaaca cgcaggcatc gtcgtcgcga cgccgctgcc ggtgcccgcg       360
     acggctggcg cggccgatac cgacgcacca ccggccgccg aaaccgacgg cgttgcgccg       420
     gacaccgacg aagcgcgggc ccaggcgtcg gcgctgcgcc tcgtcagcga acggcggcgc       480
     gggcgctggg ccgacgacag cggcgtcgtg gtcgagatga cgctcgacga catcacgctg       540
     catggcggcg gcgagccgcc gcgccgccac gtcgagctgc gtctggccgc gcccgactgg       600
     gagaccgtgg ccgcgcgcac ggcggcgctg cacgcgctgt ttgccgcggc gcgcgaactg       660
     agcggcgcgt ggccggcctt cgtgcaactg acgagcgtga tcgaccgcgc ctgtgccggc       720
     ggaccggtgg ccgccacgct ggtcaaggcg cagcccgtcg acctgaccgg catccgcacg       780
     cagcgcgccg cgctgttcgc gctgtccggc gacatcaccg cgcaatggct cggcaacgag       840
     tgcggcgtgc tcgatcgcga cgacccggaa ttcgtgcacc agatgcgcgt cgcgctgcgc       900
     cgcctgcgca cgctgatgcg cttcttcccg cgcttcaccg accgtcaatg gagggacacg       960
     ctcggcgtcg acctgcgctg gctcgccaag ctgctcggca cggtgcgcga ttgggacgtg      1020
     ttcgcgaccg agagcctgcc cgcactgatc gcggccgacg gcggcagcag cgactgggac      1080
     ggcacgctcg acgccgcccg cgcgcagtcg atggccgcgc gcgtcgagct gcggcaggcg      1140
     ctgcattcgg cccgctacgc gcggctgacg ctcggctggc tcgaatggct gagtgcgctc      1200
     gcgttgccgg cggccgatgg cgacgacgcg ccgtcgctgc ggcgtcacgc gaccaagcgc      1260
     gtacggcggc tgttcgggca tctctacgga tcgccgtcgc tcacgtcgct cgacacggcg      1320
     gcacgccacc aggtgcggat cgatgcgaag cggctgcgct acgcactcga attcttcgcg      1380
     tcgctggcgt cgcgccgcac gcgcaccgag acggtcaaga cgctggcgcg cgtgcagagc      1440
     gtgctcggcg aagcgaacga cgcgatggtc gcgctgcgtc atctcgagca actggcggcg      1500
     ccgccgtatc agctcggttt cgtgcgcggt tacggcgccg cgctcgaaca gcgggcggcg      1560
     cgcgacgccg agacgctgct ggccagcctg cggccgccga agctcgacgg caagccgggc      1620
     tga                                                                    1623
//

If you have problems or comments...

PBIL Back to PBIL home page