(data stored in ACNUC1104 zone)

EMBL: CP000959.PE484

CP000959.PE484       Location/Qualifiers
FT   CDS_pept        575495..576352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3673"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bvi:Bcep1808_4230 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3673"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92825"
FT                   /db_xref="GOA:B1K4A7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4A7"
FT                   /protein_id="ACA92825.1"
FT                   /translation="MKVLDLDAVRAFVLVADLASFTRAADALGTTQSAVSLKLKRLEAH
FT                   LGKPLLARTPRVVKLAADGENFLPAARALLDAHERALGAISTGTVRLSLGVSEHVAVPD
FT                   LPAVLTSLHRQDPGLSLEMHLGASTSLLPQYDERRFDAVIARHEPGEDPPRDDATPLFT
FT                   EPLAWLAAPDWAPRAGEPLPLAVLAGPCGVRAAALRALDRAGLPWRERFTGGGVAAVTA
FT                   AAAAGLAVCPLARRVAPRTLVDVGAKFGLPPLPQSQVVLYSRVRDARAAAALRRFADSL
FT                   AISA"
     atgaaagtac tcgatctcga tgccgtgcgc gcgttcgtgc tggtcgccga cctcgccagt        60
     ttcacgcgtg ccgccgatgc gctcggcacc acgcaatcgg ccgtcagcct gaagctgaag       120
     cgactggagg cccatctcgg caagccgctg ctggcgcgca cgccgcgcgt cgtcaagctg       180
     gccgccgacg gcgagaattt cctgccggcc gcccgtgcgc tgctcgacgc gcacgagcgt       240
     gcgctcggcg cgatctcgac cggcacggtg cgcctgtcgc tcggcgtcag cgagcacgtc       300
     gcggtgcccg acctgccggc cgtgctgacg agcctgcacc ggcaggaccc ggggctgtcg       360
     ctggaaatgc atctcggggc gtcgacgagc ctgctcccgc aatacgacga acggcggttc       420
     gacgcggtga tcgcgcggca cgagcctggc gaggacccgc cgcgcgacga cgccacgccg       480
     ctgttcaccg agccgctggc gtggctcgcc gcgcccgact gggcgccgcg cgcgggcgag       540
     ccgctgccgc tcgcggtgct ggccggcccc tgcggcgtgc gagccgccgc gctgcgcgcg       600
     ctcgatcgcg cggggttgcc gtggcgcgag cgcttcacgg gcggcggagt cgcggcggtc       660
     acggcggccg ccgcggccgg attggccgtc tgcccgctcg cgcggcgcgt cgccccgcgc       720
     acgctggtcg acgtcggcgc gaaattcggg ttgccgccgc tgccgcaatc gcaggtcgtg       780
     ctgtattcgc gcgtccgcga cgcccgcgcc gccgccgcgc tgcgcaggtt tgccgacagc       840
     cttgcaatct cggcgtaa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page