(data stored in ACNUC1104 zone)

EMBL: CP000959.PE485

CP000959.PE485       Location/Qualifiers
FT   CDS_pept        576393..577316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3674"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bmu:Bmul_4892 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3674"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92826"
FT                   /db_xref="GOA:B1K4A8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4A8"
FT                   /protein_id="ACA92826.1"
FT                   /translation="MKPDARKHLRANLLMLGAAAIWGSAFVAQRLSLDVIGPFLFTGLR
FT                   FLLGALVLVPLLMVNAASRAQLAAIRREPALLLPGLALGGLLAVSISLQQVGLQYTRIA
FT                   NAGFISSLYVVIVPLMGALARHRIGAGTWFGALLAAIGLYFLSIDEHFSVLYGDWFQLA
FT                   GAVIIAAHVMAVGHLAKRHDPLVLAFLQFAVCGVACLAVGLAVEPVSAAMLRGALPTLL
FT                   YGGLLSVGVGYTLQVVAQRDAAPAHAAVIFSMEGVFAAIAGWAALGETLTLRALVGCAL
FT                   MLAGLLACQLLPNGDARKKDEDALPA"
     atgaagcccg acgcccgcaa gcacctccgc gccaacctgc tgatgctcgg cgccgccgcg        60
     atctggggct ccgccttcgt cgcgcaacgc ctgagcctcg acgtgatcgg gccattcctg       120
     ttcaccgggc tgcgcttcct gctcggcgcg ctcgtgctgg tgccactgct gatggtgaat       180
     gcggcgtcgc gcgcgcagct cgcggcgatc cggcgcgaac cggcgctgct gctgccgggc       240
     ctcgcgctcg gcgggctgct cgccgtatcg atctcgctgc agcaggtcgg cctgcaatac       300
     acgcggatcg cgaacgccgg cttcatcagc tcgctgtacg tcgtgatcgt gccgctgatg       360
     ggcgcgctcg cgcgccaccg gatcggcgcg ggcacgtggt tcggcgcctt gctggccgcg       420
     atcggcctgt atttcctcag catcgacgag catttctcgg tgctctacgg cgactggttc       480
     cagctcgcgg gcgccgtcat catcgccgcg cacgtgatgg cggtcggcca tctcgcgaag       540
     cgccacgatc cgctcgtgct cgcgttcctg cagttcgccg tgtgcggcgt cgcgtgtctc       600
     gcggtcggcc tggcggtcga accggtcagc gccgcgatgc tgcgcggcgc gctgccgacg       660
     ctgctgtacg gcgggctgct gtcggtcggg gtcggctata cgctgcaggt cgtcgcgcaa       720
     cgcgacgcgg cgcccgcgca cgcggccgtg atcttcagca tggaaggcgt gttcgcggcg       780
     atcgccggct gggccgcgct cggcgaaacg ctgacgctgc gcgcgctggt cggctgcgcg       840
     ctgatgctgg ccggcctgct cgcgtgccag ttgctgccga acggcgacgc gcggaaaaag       900
     gacgaggacg cgctgccggc gtga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page