(data stored in ACNUC1104 zone)

EMBL: CP000959.PE486

CP000959.PE486       Location/Qualifiers
FT   CDS_pept        577384..578163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3675"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase A domain protein; KEGG:
FT                   bur:Bcep18194_B2244 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3675"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92827"
FT                   /db_xref="GOA:B1K4A9"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4A9"
FT                   /protein_id="ACA92827.1"
FT                   /translation="MTSTSVDPAADLLRERAAHYAAQAALFLRDQALSTASHDLRSPLN
FT                   AMHSWAYVLERQLANADPNLQRALAGIRTGIDQQVALIDGVLDAPRAETRTLVLAPQPF
FT                   ALRALLDETIALVRFALADARQVALDTTLPDGEPSLTVDRERVAQALWTLLTTAVEASA
FT                   AGSRVAFACTRDGAQFTARATCTVNAGVLVDPTQPHAFESFARREMLHERDAKRSAWTL
FT                   ALCQRVALAHGGTFAHDVFADGAAATLTFSIPCEAPV"
     gtgacgtcca cttccgtcga tcccgccgcc gacctgctgc gcgaacgcgc agcgcactac        60
     gccgcccagg cggcgctgtt cctgcgcgac caggccctct ccaccgcgtc gcacgacctg       120
     cgcagcccgc tgaatgcgat gcacagctgg gcctacgtgc tcgagcgcca gctcgccaat       180
     gccgatccca atctccagcg cgcgcttgcg ggcatccgca cgggcatcga ccagcaggtc       240
     gcgctgatcg atggcgtgct cgacgcgccg cgcgcggaaa cgcgcacgct cgtgctcgcg       300
     ccgcagccgt tcgcgctgcg cgcgctgctc gacgaaacaa tcgcgctcgt ccggttcgcg       360
     ctcgccgacg cacgccaggt cgcgctcgac acgacgctgc cggacggcga gccgtcgctc       420
     accgtcgatc gcgaacgcgt cgcacaggcg ctgtggaccc tgctgacgac ggccgtcgaa       480
     gccagcgccg cgggcagccg ggtcgcgttc gcctgcacgc gcgacggcgc gcagttcacc       540
     gcgcgcgcca cctgcaccgt gaatgccggc gtgctggtgg accccacgca gccgcatgcg       600
     ttcgaatcgt tcgcgcggcg cgagatgctg cacgagcgcg atgcgaaacg cagcgcatgg       660
     acgctcgcgc tatgccagcg cgtggccctc gcgcacggcg gcacgttcgc gcacgacgtg       720
     ttcgccgacg gcgcggccgc caccctcacc ttctcgattc cctgcgaggc gccggtgtaa       780
//

If you have problems or comments...

PBIL Back to PBIL home page