(data stored in ACNUC1104 zone)

EMBL: CP000959.PE487

CP000959.PE487       Location/Qualifiers
FT   CDS_pept        578240..579583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3676"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: bur:Bcep18194_B2245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3676"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92828"
FT                   /db_xref="GOA:B1K4B0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4B0"
FT                   /protein_id="ACA92828.1"
FT                   /translation="MLQIFALIGALFLVALNGFFVAAEFGLVKLRATRVKTLARKHGLR
FT                   GRILGIVHGRLDAYLSACQLGITLASLGLGWVGEPAFAQLLGPLLDLIGVHSERVVHLI
FT                   SLVFAFSLISFLHIVVGELAPKSMAIRQPEKVGLWVALPLYAFYWAMYPAIWVLNTSAN
FT                   AVLRLAGLSADHGGDAHYSTDELKLILRSRRSAAGNAAQPARGTYTNDEWNTLAHSLDF
FT                   SSMTVSDLMRPAHEMIGLRRDLPLPDNMEIVARHRFSRYPLFEDASREQVSGLIHLKDL
FT                   LLARHAGAALEDLSDYVRPVQYVKPDTPALELFRRFREGAPHFALVGNKGEKPIGFLTL
FT                   DNLLGALVGQIHDEFRQGDADWSRLDDGTLMGKGSLPVVSLEQALGIDIDEGRAESVGG
FT                   LVIQALSDLPTEGQRVSFDRFDVVVKKMNGPRIVLVRVYPKIVKEADE"
     ttgttacaga tcttcgcgct catcggcgcg ttgttcctgg tggccctgaa cgggttcttc        60
     gttgcggccg aattcggcct cgtcaaactc cgcgcgacgc gcgtcaagac cctcgcccgc       120
     aagcacggcc tgcgcgggcg catcctcggc atcgtgcacg gccggctcga cgcgtatctt       180
     tccgcgtgcc agctcggcat cacgctcgca tcgctcggcc tcggctgggt cggcgaaccg       240
     gcgttcgcgc aactgctcgg cccgctgctc gacctgatcg gcgtccactc cgagcgcgtc       300
     gtgcacctga tctcgctcgt gttcgcgttc tcgctgatct cgttcctgca catcgtcgtc       360
     ggcgaactgg cgccgaagtc gatggcgatc cgtcagccgg agaaggtcgg cctgtgggtc       420
     gcgctgccgc tctacgcgtt ctactgggcg atgtatccgg cgatctgggt gctcaacacc       480
     agcgccaacg cagtgctgcg gctcgcaggg ctgtcggccg accacggcgg cgatgcgcac       540
     tattcaaccg acgagctgaa gctgatcctg cgcagccgcc gcagcgcggc cggcaatgcg       600
     gcccagccag cgcgcggcac gtacaccaac gacgagtgga acacgctcgc gcattcgctc       660
     gatttttcgt cgatgaccgt gtcggacctg atgcggccgg cccatgaaat gatcggcctg       720
     cggcgcgacc tgccgctgcc cgacaacatg gagatcgtcg cgcggcaccg cttcagccgc       780
     tatccgctgt tcgaggatgc gtcgcgcgaa caggtgagcg ggctgatcca cctgaaggac       840
     ctgctgctcg cgcgtcacgc gggcgccgcg ctcgaggatc tctccgacta cgtgcgcccg       900
     gtccagtacg tgaagcccga tacgccggcg ctggagctgt tccgccgctt ccgcgagggc       960
     gccccgcact tcgcgctggt cggcaacaag ggcgagaagc cgatcggctt cctgacgctc      1020
     gacaacctgc tcggcgcgct ggtcggccag atccacgacg aattccgcca aggcgacgcc      1080
     gactggagcc gcctcgacga cggcacgctg atgggcaagg gcagcctgcc cgtcgtgtcg      1140
     ctcgagcagg cgctcggcat cgacatcgac gaaggccgcg cggaatcggt cggcggcctc      1200
     gtgatccagg cgttgagcga cctgccgacc gaagggcagc gcgtgtcgtt cgaccgcttc      1260
     gacgtcgtcg tgaagaagat gaacgggccg cgcatcgtgc tcgtgcgcgt ctatccgaag      1320
     atcgtgaaag aggccgacga atga                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page