(data stored in ACNUC1104 zone)

EMBL: CP000959.PE489

CP000959.PE489       Location/Qualifiers
FT   CDS_pept        complement(580263..581915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3678"
FT                   /product="glycoside hydrolase family 13 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 13 domain protein;
FT                   KEGG: bur:Bcep18194_B2247 glycoside hydrolase, family
FT                   13-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3678"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92830"
FT                   /db_xref="GOA:B1K4B2"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4B2"
FT                   /protein_id="ACA92830.1"
FT                   /translation="MSDCPHDPYAQHYIHCLPFGAQPCGALSTTPRTHFRVWAPGSTHV
FT                   QLELNTGYGPMLVPMTSAGPNWFEVFVDCGAGARYRYRLDDTVSIPDPASRSQPEGLNG
FT                   PSEVVDPRAFTWRNTFWHGRAWEDVALYAIRPHAVGGFDAVRRRLPQLARLGVTALELL
FT                   ASPHDSLPFAPLAAEGGPDELKALIDAAHGYGLAVLLELDYARFGSGTDALRHYAGPFF
FT                   HTRDDPLQAAPLALDHPEVCDFFCDNALYWIDEYRCDGLRLREADRIGVSWLREIADRV
FT                   RAAVPADRLIHLVLGSERHPAHLADTHFDAQWNGCGERALHRLTGRDPSAHEGISAHQS
FT                   IHTLARALTAAGAAYQPAASSDGMGADGGLSLTSLVLSDGAWRDGGPGDPGQAAGLAAL
FT                   ALSLLTPQIPLIFDETARDIDRAHFVQSALAVRAKLIAPRLSDCRPQAAHALKADGDGD
FT                   ADALCASWRLADDETLTIALNLSPDAVPFDAPGGRVVFETPARARDRVDEGELPPYSLV
FT                   AWLTGDVNRYALTHDVRRLDDGSWRGMRPNLNA"
     atgtccgatt gtccgcatga tccgtacgcg cagcactaca tccattgttt gccgtttggc        60
     gcgcagccct gcggcgcgct cagcacgacg ccgcgcacgc atttccgcgt gtgggcgccc       120
     ggcagcaccc acgtccagct cgaactgaat accggctacg gcccgatgct ggtgccgatg       180
     acgagcgccg gcccgaactg gttcgaagtg ttcgtcgact gcggcgcggg cgcacgttac       240
     cgctatcgtc tcgacgatac cgtgtcgatt cccgatcccg cgtcgcgttc gcaacccgag       300
     gggctcaacg ggccgagcga ggtcgtcgat ccgcgcgcgt tcacgtggcg caatacgttc       360
     tggcacgggc gcgcatggga ggacgtcgcg ctctacgcga tccgcccgca cgcggtgggc       420
     ggcttcgacg ccgtgcgccg ccgcctgccg cagctcgcgc gcctcggtgt gaccgcgctg       480
     gagctgctcg cgtcgccgca cgacagcctg ccgttcgcgc cgctcgcggc cgaaggcggc       540
     cccgacgagc tgaaggcgct gatcgacgcc gcgcacggct acggtctcgc ggtgctgctg       600
     gagctcgact acgcgcgctt cggcagcggc accgacgcgc tgcgccacta tgcggggccg       660
     ttcttccata cgcgcgacga tccgctgcag gccgcgccgc tcgcgctcga tcatccggaa       720
     gtctgcgatt tcttctgcga caacgcgctg tactggatcg atgaataccg ttgcgacggg       780
     ctgcgcctgc gcgaagccga ccggatcggc gtgtcgtggc tgcgcgagat cgcggatcgc       840
     gtgcgcgccg ccgtgccggc cgaccggctg atccacctcg tgctcggcag cgagcggcat       900
     ccggcgcatc tggccgatac ccatttcgac gcgcagtgga acggctgcgg cgaacgtgcg       960
     ctgcaccggc tcacggggcg tgacccgtcg gcgcatgaag gcatttccgc gcaccagtcg      1020
     atccacacgc tcgcccgcgc gctgaccgcg gccggcgcgg cgtaccagcc ggccgcgtcg      1080
     tctgacggga tgggcgccga cggtggactg tcgctgacgt cgctcgtgct gtccgatggc      1140
     gcatggcgcg acggcggccc cggcgatccc gggcaggcgg ccggtctggc cgcgctcgcg      1200
     ctgtcgctgc tcacgccgca gatcccgctg atcttcgacg agactgcgcg cgacatcgat      1260
     cgcgcgcatt tcgtgcagtc ggcgctcgcg gtgcgcgcga agctgatcgc gccgcggctg      1320
     tccgattgcc ggccgcaggc agcccatgcg ctgaaggcgg acggcgacgg cgatgccgac      1380
     gcgctgtgcg cgtcatggcg gctcgccgac gacgagacgt tgacgatcgc gttgaacctg      1440
     tcgccggatg cggtgccgtt cgatgcaccg ggcgggcggg tggtgttcga gacgccggcg      1500
     cgcgctcgcg accgggtcga tgaaggggaa ttgccgccgt attcgctcgt cgcgtggctg      1560
     accggcgacg tcaatcgcta cgcgctgacg cacgacgtgc gtcgcctcga cgacggttcg      1620
     tggcgcggca tgcgtccgaa cctgaacgca tga                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page