(data stored in ACNUC1104 zone)

EMBL: CP000959.PE490

CP000959.PE490       Location/Qualifiers
FT   CDS_pept        582231..582938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3679"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bur:Bcep18194_B2248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3679"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92831"
FT                   /db_xref="GOA:B1K4B3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4B3"
FT                   /protein_id="ACA92831.1"
FT                   /translation="MSLPASAAKFDPSRAHEYAEQSRIALAGYDACHELAACMLASAIG
FT                   ATDARILVAGAGGTGQEICVAAALEPGWQFTAVDPSAPMLALARSNVEAAGFGARTAFV
FT                   EDGVDALPDAPAFDGATLIGVLHHVPGDDAKAALLHAIARRLKPGAPLVLAGNHRRYAD
FT                   HPRLLDAWQQRWRMKGATSDAVRAQLAKILQGADPPASEEAVFALLRDAGFDAPLRFFA
FT                   SLFWGAWIAVRRA"
     atgtcgcttc ccgccagcgc cgcgaaattc gatccgtcac gcgcgcacga atacgccgaa        60
     caatcgcgca tcgcgctcgc cggctacgat gcctgtcacg aactcgccgc ctgcatgctc       120
     gcgtcggcga tcggtgcgac cgatgcccgg attctcgtgg ccggcgcggg cggcacgggg       180
     caggaaatct gcgtagcagc cgcgctcgaa ccgggctggc aattcacggc cgtcgacccg       240
     tccgcgccga tgctcgcgct cgcgcgctcg aatgtcgaag ccgcgggttt cggcgcgcgt       300
     accgcgttcg tcgaggatgg cgtcgacgcg ttgcccgatg cgcccgcgtt cgacggcgcg       360
     acgctgatcg gcgtgctgca tcacgtgccg ggcgacgacg cgaaagccgc gctgctgcat       420
     gcgatcgcgc ggcgactgaa gcccggcgcg ccgctcgtgc tcgccggcaa ccatcgccgc       480
     tacgcggacc acccgcgcct gctcgacgcc tggcagcagc gctggcgcat gaagggcgcc       540
     acgtccgacg ccgtgcgcgc gcaactcgcg aagatcctgc agggcgccga tccgcccgcg       600
     tccgaggaag ccgtgttcgc gctgctgcgc gacgcgggct tcgatgcgcc gctgcgtttt       660
     ttcgcgagcc tgttctgggg cgcgtggatc gcggtgcggc gcgcttga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page