(data stored in ACNUC1104 zone)

EMBL: CP000959.PE495

CP000959.PE495       Location/Qualifiers
FT   CDS_pept        complement(585988..586407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3684"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3684"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92836"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4B8"
FT                   /protein_id="ACA92836.1"
FT                   /translation="MSQPAYESHSALPHASVAQMSAAGLRAFFNIARDWELTIDEQIVL
FT                   LGSPGRSTFFKWKAAPESARLPRDTLERLSLLLGIYKGLQILLPQPAAADAWVKRPNDA
FT                   APFGGKRALDRMLAGNVGDLVAVRQYLDAMRGGWA"
     atgtcacagc ccgcctatga atcgcattcc gccttgccgc acgcttcggt cgcgcagatg        60
     tcggcggccg gcctgcgtgc gtttttcaac atcgcgcgcg actgggaact gacgatcgac       120
     gagcagatcg tgctgctcgg gtcgcccggc cgctcgacgt tcttcaagtg gaaggccgcg       180
     ccggaatcgg cgcgcctgcc gcgcgatacg ctcgagcggc tgtcgctctt gctcggtatc       240
     tacaagggct tgcagatcct gctgccgcag cccgctgcgg ccgatgcttg ggtcaagcgg       300
     cccaacgatg cggcgccgtt cggcggcaag cgcgcgctcg accggatgct ggccggcaac       360
     gtcggcgacc tggtggccgt gcggcaatat ctcgatgcga tgcggggtgg ctgggcgtga       420
//

If you have problems or comments...

PBIL Back to PBIL home page