(data stored in ACNUC1104 zone)

EMBL: CP000959.PE496

CP000959.PE496       Location/Qualifiers
FT   CDS_pept        586642..587424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3685"
FT                   /product="cationic amino acid ABC transporter, periplasmic
FT                   binding protein"
FT                   /note="TIGRFAM: cationic amino acid ABC transporter,
FT                   periplasmic binding protein; PFAM: extracellular
FT                   solute-binding protein family 3; KEGG: bur:Bcep18194_B2254
FT                   ABC amino acid transporter, periplasmic ligand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3685"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92837"
FT                   /db_xref="GOA:B1K4B9"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4B9"
FT                   /protein_id="ACA92837.1"
FT                   /translation="MKRLIAAVSIALLAVSAGPAVAKDWTTIRFGTDASYAPFESKAPD
FT                   GKLVGFDIDLGNEICARLKAKCVWLENDFDGMIPALKAKKFDAVLSSMSITPQRAQQIG
FT                   FTTKIYNQPTRLVVKKGSSLLPTAASLKGKSIGVEQGTTQETYAKAYWGKQGANVVSYQ
FT                   NQDGVYADLIAGRLDAALQDEVQAAIGFLKSPRGANYTFVGPELVDEKVLGIGAGIGLR
FT                   QEDTDLKAKIDRAIHDMVKDGTYKRLASKYFDFDIYGG"
     atgaagagac tgattgccgc tgtttcgatc gccctgctcg cggtatccgc aggccccgcc        60
     gtcgcgaagg actggaccac gatccgcttc ggcaccgacg ccagctacgc gccgttcgaa       120
     tcgaaggcgc cggacggcaa gctcgtcggc ttcgacatcg acctcggcaa cgagatctgc       180
     gcgcgcctga aggccaaatg cgtgtggctc gagaacgatt tcgacgggat gattccggcg       240
     ctgaaggcga agaagttcga cgcggtgctg tcgtcgatgt cgatcacgcc gcagcgcgcg       300
     cagcagatcg gcttcacgac gaagatctac aaccagccga cgcggctcgt cgtgaagaag       360
     ggctcgtcgc tgctgccgac cgccgcatcg ctgaagggca aatcgatcgg cgtcgagcag       420
     ggcacgacgc aggaaacgta tgcgaaggcg tactggggca agcaaggcgc gaacgtcgtg       480
     tcgtaccaga accaggacgg cgtgtatgcc gacctgatcg ccggccgcct cgacgcggcc       540
     ctccaggatg aagtgcaggc cgcgatcggg ttcctgaaat cgccgcgcgg cgcgaactac       600
     acgttcgtcg ggcccgagct cgtcgacgaa aaggtgctcg gcatcggcgc cggcatcggt       660
     ttgcgccagg aggacaccga cctgaaggcg aagatcgacc gcgcgatcca cgacatggtc       720
     aaggacggca cctacaagcg gctcgcatcg aagtacttcg acttcgacat ctacggcggt       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page