(data stored in ACNUC1104 zone)

EMBL: CP000959.PE497

CP000959.PE497       Location/Qualifiers
FT   CDS_pept        588509..588895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3686"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: bur:Bcep18194_B2257
FT                   GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3686"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92838"
FT                   /db_xref="GOA:B1K4C0"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4C0"
FT                   /protein_id="ACA92838.1"
FT                   /translation="MIRTFHAAERARLIRFGVSGVGSTALHALIAAAMFALFDATPVIA
FT                   NATAFVCSTAFSYLANTLWSFSSPVTWGNFVRFLAVAMAGLAVTMLLAHGTDALGLARA
FT                   WSIVAVVLCVPPVTFVLHRLWTYR"
     atgatccgta ccttccatgc cgccgagcgc gccaggctga tccgcttcgg cgtgtccggt        60
     gtcggctcga ccgcgctgca tgcgctgatc gccgccgcga tgttcgcgct gttcgacgcg       120
     acgcccgtca tcgcgaacgc gaccgcgttc gtctgctcga ccgcgttctc gtatctcgcc       180
     aacacgctgt ggagtttttc gtcgccggtg acgtggggca acttcgtgcg ctttctcgcg       240
     gtcgcgatgg ccggcctggc cgtgacgatg ctgctggcgc acggcaccga cgcgctcggg       300
     ctcgcgcgcg cgtggagcat cgtcgcggtc gtgctgtgcg tgccgcccgt cacgttcgtg       360
     ctgcaccggc tgtggaccta tcgctga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page