(data stored in ACNUC1104 zone)

EMBL: CP000959.PE50

CP000959.PE50        Location/Qualifiers
FT   CDS_pept        59466..60728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3235"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: bam:Bamb_6542
FT                   cobalamin synthesis protein, P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3235"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92391"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8P4"
FT                   /protein_id="ACA92391.1"
FT                   /translation="MTTPGNRHVPAAPPPRIPVTVLSGFLGAGKTTLLNHILRNRAGLK
FT                   VAVIVNDMSEVNVDADDVRRNVELHRGEDELVEMTNGCICCTLRADLLEQISTLARQHR
FT                   FDYLLIESTGISEPMPVAETFAFLDRDGFSLSELARLDTLVTVVNGETFEDMIASAEPV
FT                   TRDAPLANGSDADPPRKLSDLLIEQVEYANVILVSRLDRIGHAGFARLRAILASLNPSA
FT                   RILPMQHGKVDPSDVLDTRRFDLPALVESPGWMQRMQADERPPESDAYGIASWVYRERA
FT                   PFHPARLLAWLRRRWTNGRLLRCKGYVWAAHRYAETAMLVQAGDTFQWGYVGRWWRFTP
FT                   PSDWPQDGYRREGVLKQWEEPAGDCRQEIVFIGQSIDHVQLRRELDACLLTVAEIDAGP
FT                   ESWRQLPEADAFDALATPAQP"
     atgacgacgc cgggcaatcg acacgtgccg gccgccccgc cgccgagaat tccggtcacc        60
     gtgctgtccg gcttcctcgg cgccggaaag acgacgttgc tgaaccacat cctgcgcaat       120
     cgcgccggcc tgaaggtcgc cgtgatcgtc aacgacatga gcgaagtcaa cgtcgacgcc       180
     gacgacgtgc ggcgcaacgt cgagctgcat cgaggcgagg acgaactggt cgaaatgacc       240
     aacggctgca tctgctgcac gctgcgcgcc gatctgctcg agcagatcag cacgctggcg       300
     cggcagcatc gcttcgatta cctgctgatc gagtcgacgg gtatctcgga gccgatgccg       360
     gtcgcggaga cgttcgcgtt tctcgaccgg gacggtttca gcctcagcga actcgcgcgg       420
     ctggacacgc tcgtcacggt ggtcaacggc gagacgttcg aggacatgat cgcgtcggcc       480
     gaaccggtca cgcgcgacgc cccgctcgcg aacggcagcg atgccgatcc gccgcgcaag       540
     ctgtcggatc tgctgatcga acaagtcgaa tatgcgaacg tgatcctcgt gagccgactc       600
     gaccggatcg gccacgcggg tttcgcgcgg ctgcgcgcaa ttctggcctc actgaatcca       660
     tcagcgcgaa tcctgccgat gcagcacggc aaggtcgatc cgtcggacgt cctcgatacg       720
     cggcgcttcg atctgccggc gctcgtcgaa tcgccgggat ggatgcaacg catgcaggcc       780
     gacgaacgcc cgccggaatc ggatgcgtac ggcatcgcgt cgtgggtcta tcgcgaacgt       840
     gcgccgtttc atcctgcgcg cctgctcgcg tggctgcggc gccgctggac caacggccgg       900
     ctgcttcgct gcaagggcta tgtgtgggcc gcgcaccgat atgcggaaac cgccatgctc       960
     gtgcaggccg gcgacacgtt ccagtggggc tacgttggcc gatggtggcg gtttacccca      1020
     ccgtcggact ggccgcagga cggctatcgt cgcgagggtg tgctgaagca atgggaagaa      1080
     ccggcgggcg attgccgtca ggaaatcgtg ttcatcgggc agtcgatcga tcacgtccag      1140
     ctgcgtcgcg aactcgatgc gtgcctgctg acggtcgcgg aaatcgacgc aggcccggag      1200
     tcgtggcgcc agcttccgga agccgacgcg ttcgacgcgc tcgcgacgcc cgcccagccg      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page