(data stored in ACNUC1104 zone)

EMBL: CP000959.PE501

CP000959.PE501       Location/Qualifiers
FT   CDS_pept        592743..593516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3690"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bam:Bamb_5558 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3690"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92842"
FT                   /db_xref="GOA:B1K4C4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4C4"
FT                   /protein_id="ACA92842.1"
FT                   /translation="MERIASPAIALRRYDTCEASDVHDFHQVVLGVDGAMVMAVDGIGR
FT                   RIDRHAAWLIPAGARHDYAGLGDNRQLVIDLPAASLAVPQRLFDHARAVSIDPALTSLV
FT                   AQVAAAAAQHDAPDGDARQAAAHRFQWQAAARLCDALLDDAGIAAPASGLDFARIDRWL
FT                   RARLADPLRIADLAAHCGYGMRRFHQLFVDAFGETPHRYLQRLRLDAAVVLLADGRHAL
FT                   VDIAGSVGFADQSTFTHAFTKRFGVAPGRWRGERH"
     atggaacgca tcgcctcccc cgccatcgcg ctgcgccgct acgacacgtg cgaagcgtcg        60
     gacgtgcacg acttccacca ggtcgtgctc ggcgtcgacg gcgcgatggt gatggcggtg       120
     gacggaatcg gccgtcgcat cgaccggcac gcggcctggc tgattccggc cggcgcgcgc       180
     cacgactacg cgggcctcgg cgacaatcgc cagctcgtga tcgacctgcc cgccgcgtcg       240
     ctcgcggtgc ctcagcgact gttcgaccat gcgcgcgccg tgtcgatcga cccggcgctc       300
     acgtcgctcg tcgcgcaggt cgcggcggcg gccgcgcaac acgatgcacc ggacggcgac       360
     gcacggcagg ccgccgcgca ccgtttccag tggcaggccg cggcacgcct gtgcgacgca       420
     ctgctcgacg atgcgggcat cgccgcgccc gcgtcgggcc tcgatttcgc gcgcatcgac       480
     cgctggctgc gcgcgcggct cgccgacccg ctgcgcatcg ccgatctcgc cgcgcactgc       540
     ggctacggga tgcgccggtt tcatcaactg ttcgtcgacg ccttcggcga aacgccgcat       600
     cgctacctgc agcggctgcg gctcgacgcg gccgtcgtgc tgctcgccga cggccggcat       660
     gcgctcgtcg acatcgcggg cagcgtcggc ttcgcggatc agagcacgtt cacgcatgcg       720
     ttcacgaagc gcttcggcgt ggcgccggga cgctggcgcg gcgaacggca ctga             774
//

If you have problems or comments...

PBIL Back to PBIL home page