(data stored in ACNUC1104 zone)

EMBL: CP000959.PE51

CP000959.PE51        Location/Qualifiers
FT   CDS_pept        60916..61503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3236"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bur:Bcep18194_B1731 lysine exporter family protein
FT                   (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3236"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92392"
FT                   /db_xref="GOA:B1K8P5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8P5"
FT                   /protein_id="ACA92392.1"
FT                   /translation="MSMLVSMAAFALASSITPGPVNIVALSAGARHGLGASLRYAAGAT
FT                   LGFVALFLLIGLGLHAALARWPVLTTATQWSGIAFLLYMALRLALDDGRLSADPDVAGP
FT                   SAASGAAMQWLNPKAWLACVAAMGAYAADGDRAQVWQFAALYLVICFASIACWGYAGAS
FT                   LRHRLANARRMRVFNRLMALLLAGSALFLLDV"
     atgagcatgc tggtttcgat ggccgcgttc gcgctcgcct cgtcgatcac ccccggtccc        60
     gtcaacatcg tcgcgctcag cgcgggcgcc cgccatggcc tcggcgcgag cctgcgctac       120
     gcggcgggcg cgacgctcgg cttcgtcgcg ctgttcctgc tgatcggcct cggcctgcac       180
     gcggcgctcg cgcgctggcc cgtgctgacg acggccacgc agtggtcggg aatcgcgttt       240
     ctgctgtata tggcgctgcg gctcgcgctc gacgacggcc ggctgtcggc cgatcccgac       300
     gtggccggcc cgtcggcggc gtccggcgcg gcgatgcagt ggctcaatcc gaaggcgtgg       360
     cttgcgtgcg tggccgcgat gggcgcgtat gcggccgatg gcgatcgcgc gcaggtctgg       420
     cagttcgccg cgctgtatct ggtgatctgc ttcgcgtcga tcgcatgctg gggctatgcg       480
     ggtgcgtcgc tgcggcaccg gctcgcgaac gcgcggcgca tgcgcgtgtt caaccggctg       540
     atggcgctgc tgctcgcggg cagcgcgctg tttctgctcg acgtgtag                    588
//

If you have problems or comments...

PBIL Back to PBIL home page