(data stored in ACNUC1104 zone)

EMBL: CP000959.PE512

CP000959.PE512       Location/Qualifiers
FT   CDS_pept        complement(606316..607494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3701"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; KEGG:
FT                   bur:Bcep18194_B2273 polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3701"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92853"
FT                   /db_xref="GOA:B1K4D5"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4D5"
FT                   /protein_id="ACA92853.1"
FT                   /translation="MLKRPMRPVALAVALTTFLSACATAPGNYLDSSNLKDEGRQEAAE
FT                   TYPVHYIDAKVVMDQLQKAQVDHPLPPGRYTDPSQYTYRVGPQDILGVTVWDHPELTTP
FT                   QGQSFSSGGNTTQSVAGALQQPYTTALPGQADPYGQTVAADGTIFFPFVGRIRVAGKTV
FT                   AQIRDEMASSLSRYVKNPQLDVRVLSFRSQKVQVTGEVKQPGPLAVSDVPLTLVDAISR
FT                   SGGSTAEADLQRVRLTRDGKLYTLDANGVLDRGEVKQNVMLQPGDIVNVPDRSDSRVFI
FT                   MGEVKTPVTVPMLKGKLTIADALTAGGGILDTDANPRKIYVMRGMRDNPTKPEVYRLDM
FT                   TQPDALMLSSRFPLQPLDVVYVSTAGSVQFNRVLQQVLPTIQTIFYMRQITR"
     atgctgaaac gcccgatgcg cccggtggcg cttgccgtcg cgctgacgac tttcctgtca        60
     gcctgtgcaa ccgcgcccgg caactacctc gactcgtcga acctgaagga cgaaggccgg       120
     caggaagcgg ccgaaaccta tccggttcat tacatcgacg ccaaagtggt gatggaccag       180
     ctgcagaaag cgcaggtcga tcatccgctg ccgcccgggc gctataccga tccgtcgcag       240
     tacacgtatc gcgtcggccc gcaggacatc ctcggcgtca ccgtgtggga ccacccggag       300
     ctgacgacgc cgcagggcca gtcgttctcg agcggcggca acacgacgca atcggtcgcg       360
     ggcgcgctgc agcagccgta tacgaccgcg ctgccgggcc aggccgatcc gtacggccag       420
     acggtcgccg ccgacggcac gatcttcttc ccgttcgtcg gccgcatccg cgtggcgggc       480
     aagacggtcg cgcagatccg cgacgagatg gcgtccagcc tgtcgcgcta cgtgaagaat       540
     ccgcagctcg acgtgcgcgt gctgtcgttc cgcagccaga aggtacaggt gacgggcgag       600
     gtgaagcagc cgggcccgct cgcggtgagc gacgtgccgc tcacgctcgt cgacgcgatc       660
     tcgcgctccg gcggctcgac cgccgaggcc gacctgcagc gcgtgcgcct gacgcgcgac       720
     ggcaagctct acacgctcga cgcgaacggc gtgctcgatc gcggcgaagt gaagcagaac       780
     gtgatgctgc agccgggcga catcgtcaac gtgccggacc gcagcgacag ccgcgtgttc       840
     atcatgggcg aggtcaagac gccggtcacg gtgccgatgc tcaagggcaa gctgaccatc       900
     gccgatgcgc tgaccgcggg cggcgggatt ctcgacaccg acgcgaaccc gcgcaagatc       960
     tacgtgatgc gcgggatgcg cgacaacccg acgaagcccg aggtgtaccg cctcgacatg      1020
     acgcagcccg atgcgctgat gctgtcgagc cgcttcccgc ttcaaccgct cgacgtcgtc      1080
     tacgtcagca cggccggttc ggtgcagttc aaccgtgtgc tgcagcaggt gctgccgacg      1140
     atccagacga tcttctacat gcggcaaatc acgcgctga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page