(data stored in ACNUC1104 zone)

EMBL: CP000959.PE513

CP000959.PE513       Location/Qualifiers
FT   CDS_pept        complement(607488..607931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3702"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: bur:Bcep18194_B2274 protein tyrosine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3702"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92854"
FT                   /db_xref="GOA:B1K4D6"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4D6"
FT                   /protein_id="ACA92854.1"
FT                   /translation="MFRNILIVCHANVCRSPAAEMLFKSHAASRGGPRPTFHSAGVHAN
FT                   DGDGIDPVMRRLLAERGVDATTHRSRRLSRRIVRDADLILVSEREQIKAVEAVDPFARG
FT                   KVHLLGKWEGAEIADPHGGPEADYRESYSLIERLVQGWLQKLC"
     atgttccgga acatcctgat cgtctgccac gcgaacgtct gccgcagccc ggcggcggaa        60
     atgctgttca agtcgcacgc cgcgtcgcgc ggcggcccgc gcccgacgtt tcattcggcc       120
     ggcgtgcacg cgaacgacgg cgacggcatc gatccggtga tgcggcgact gctggccgag       180
     cggggcgtcg atgcgacgac ccatcgctcg cggcggctgt cgcgccggat cgtgcgcgac       240
     gccgacctga ttctcgtcag cgagcgcgaa cagatcaagg ccgtcgaagc ggtcgatccg       300
     ttcgcgcgcg gcaaggttca cctgctcggc aagtgggaag gggccgagat cgcggacccg       360
     cacggcggcc ccgaggccga ctaccgcgag agctactcac tgatcgaacg tctggttcaa       420
     ggatggctac agaaactatg ctga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page