(data stored in ACNUC1104 zone)

EMBL: CP000959.PE518

CP000959.PE518       Location/Qualifiers
FT   CDS_pept        complement(614607..615188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3707"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3707"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92859"
FT                   /db_xref="InterPro:IPR021890"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4E1"
FT                   /protein_id="ACA92859.1"
FT                   /translation="MTLTRDSLLTLEAYAKIRKAEHARLVAYKRRRAVALGNHLRFLFE
FT                   DETTIRYQIHEMLHIEKIFDEAGIEGELEAYLPLVPDGTNLKATMQIEYEHEIERRAAL
FT                   ARLIGVEDRVYLQVDGYASVYAIADEDLERDNAEKTSAVHFVRFEFDAPMRAALKGGAA
FT                   LSIGCDHPAYTMPPQRVDADVAASLAGDLR"
     atgacgctga cccgcgactc cctgctgacg ctcgaagcgt acgcgaagat ccgcaaggcc        60
     gaacacgcgc ggctcgtcgc gtacaagcgc cgccgcgcgg tggcgctcgg caaccacctg       120
     cgtttcctgt tcgaggacga gacgacgatc cgctaccaga tccacgagat gctgcacatc       180
     gagaagatct tcgacgaagc cggcatcgaa ggggagctgg aagcgtatct gccgctggtg       240
     cccgacggca ccaacctgaa ggcgacgatg cagatcgagt acgagcacga gatcgaacgg       300
     cgcgcggcgc tcgcgcggct gatcggtgtc gaggatcgcg tgtacctgca ggtcgacgga       360
     tacgcgagcg tctacgcgat cgccgacgag gatctcgagc gcgacaacgc ggagaaaacc       420
     tcggccgtgc acttcgtccg cttcgagttc gatgcgccga tgcgcgcggc gctcaagggc       480
     ggggcggcgc tgtcgatcgg ctgcgatcac ccggcctaca cgatgccgcc gcagcgggtg       540
     gacgcggacg tggccgcatc gctcgcgggc gatctgcgct ag                          582
//

If you have problems or comments...

PBIL Back to PBIL home page