(data stored in ACNUC1104 zone)

EMBL: CP000959.PE519

CP000959.PE519       Location/Qualifiers
FT   CDS_pept        complement(615218..616555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3708"
FT                   /product="Fe-S oxidoreductase-like protein"
FT                   /note="KEGG: bam:Bamb_5542 Fe-S oxidoreductase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3708"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92860"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4E2"
FT                   /protein_id="ACA92860.1"
FT                   /translation="MPHKEGSLEAPTRHPLDWQSEAFYDQAAIDAEMTRVFDICAGCRR
FT                   CVSLCGAFPALFDLVDDTPMGDVEEVPKAAFGKVVDQCYLCDLCYMTKCPYVPPHAWNV
FT                   DFPHLMLRAKAARYKRGEAPLRDKVLSNTDALGHFAGIPVVTQTINAVNRTPPARHALE
FT                   AALGVDRHAWLPEFAPRTFRRAATRSDDPPVRDGERTPGKVAIYATCYVNFNEPGIGHD
FT                   LLAILAHNEIPYELVTREACCGMPLLEQGNLDGVAAKKAINIPVLERYAREGYALIGAI
FT                   PSCVLMYKSELPLMFPGDAAVRAVADAFWDPFEYVIARHRDGLLKTDFKTGLGTVSYHV
FT                   PCHARVQNIGRKTADALSLVPDTRVNVVERCSGHAGTFGVKKAFHADAMRIGAPVFKAM
FT                   AEPRPDVVSSDCALAGHHIAQGIDEKGLPEAPLAHPLTLLRRAYGI"
     atgccccaca aggaaggcag tctcgaagcg ccgacccggc atccgctcga ctggcagtcc        60
     gaagcgttct acgaccaggc ggcgattgat gcggaaatga cgcgcgtatt cgacatttgc       120
     gccggctgcc ggcgctgcgt gtcgttgtgc ggcgcgttcc cagcgctgtt cgacctggtc       180
     gacgacacgc cgatgggcga cgtcgaggaa gtgccgaagg ccgcgttcgg caaggtcgtc       240
     gaccagtgct atctgtgcga tctctgctac atgacgaaat gtccgtacgt gccgccgcac       300
     gcatggaacg tcgatttccc gcacctgatg ctgcgcgcca aggccgcgcg ctacaaacgc       360
     ggcgaagcgc cgctgcgcga caaggtgctg tcgaataccg atgcgctcgg ccatttcgcg       420
     ggcattccgg tcgtcacgca gacgatcaac gcggtgaacc gcacgccgcc cgcgcgccac       480
     gcgctcgaag cggcgcttgg tgtcgatcgc catgcgtggc tgccggaatt cgcgccgcgc       540
     acgttccggc gcgccgccac gcgctcggac gacccgcccg tgcgcgacgg cgaacgcacg       600
     cccggcaagg tcgcgatcta cgcgacgtgc tacgtgaatt tcaacgagcc gggaatcggc       660
     cacgacctgc tcgcgatcct cgcgcacaac gagatcccgt acgaactcgt cacgcgcgaa       720
     gcgtgctgcg ggatgccgct gctcgagcag ggcaatctcg acggcgtcgc cgcgaagaag       780
     gccatcaaca tcccggtgct cgagcgctac gcgcgcgaag gctatgcatt gatcggcgcg       840
     attccgagct gcgtgctgat gtacaagagc gagctgccgc tgatgttccc cggcgacgca       900
     gccgtgcgcg cggtggccga cgcgttctgg gacccgttcg aatacgtgat cgcgcggcac       960
     cgcgacgggt tgctcaagac cgatttcaag accggcctcg gcaccgtgtc gtatcacgtg      1020
     ccgtgccacg cgcgcgtgca gaacatcggc cgcaagacgg ccgatgcgct gtcgctggtg      1080
     cccgatacgc gcgtgaacgt cgtcgagcgt tgctccggcc atgcgggcac gttcggcgtg      1140
     aagaaggcat ttcacgcgga cgcgatgcgg atcggcgcgc cggtgttcaa ggcgatggcc      1200
     gagccgcggc cggatgtcgt gtcgtccgac tgcgcgctcg ccggccatca catcgcgcag      1260
     ggcatcgacg agaaggggct gccggaagcg ccgctcgcgc atccgctgac gctgctgcgt      1320
     cgcgcgtacg gcatctga                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page