(data stored in ACNUC1104 zone)

EMBL: CP000959.PE52

CP000959.PE52        Location/Qualifiers
FT   CDS_pept        complement(61516..62361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3237"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   KEGG: bur:Bcep18194_B1732 transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3237"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92393"
FT                   /db_xref="GOA:B1K8P6"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8P6"
FT                   /protein_id="ACA92393.1"
FT                   /translation="MSRTANRSAVPSPFWRDTALPFIEARTVDDGRAICYAKHTHDTFS
FT                   VGAIVGGTSTYVNGATNAHVGRGVLVIIDPEQVHACNPYGPDAWAYRMVYVDVPWLARL
FT                   QHSLGGDPNRDFHGFSPKLTERGDLFARFGGFYRTLVSPDIDALGKESAAVEFFTALHG
FT                   ALDRELPDPRPGDDNAKLARAADYIAAHCREAVTLDAICAAADLSPSYLIRAFNARYGM
FT                   TPHAFLIDRRVQYGRTELRRGRPIAEVALDAGFADQAHFQRAFRRIAAATPGQYRGAMR
FT                   "
     gtgagccgta ccgccaaccg atccgccgta ccgtcgccgt tctggcgcga taccgcgctg        60
     ccgttcatcg aggcgcgcac cgtcgacgac gggcgcgcga tctgctacgc gaagcacacg       120
     cacgacacgt tttcggtggg cgcgatcgtc ggcggcacga gcacgtacgt gaacggtgcg       180
     acgaacgcgc atgtcgggcg cggcgtgctg gtgatcatcg acccggagca ggtgcacgcg       240
     tgcaacccgt acggccccga tgcatgggcg taccggatgg tctatgtcga cgtgccgtgg       300
     ctcgcgcggc tgcaacattc gctgggcggc gatccgaacc gcgattttca tgggttttcg       360
     ccgaagttga ccgagcgcgg cgatctgttc gcgcgatttg gcggcttcta ccgcacgctg       420
     gtgtcgcccg acatcgatgc gctcggcaag gagagtgcgg cggtcgaatt cttcacggcg       480
     ctgcacggcg cgctcgaccg cgaactgccc gacccgcggc cgggcgacga caacgcgaag       540
     ctcgcgcgcg cggccgacta catcgccgcc cattgccgcg aggccgtcac gctcgatgcg       600
     atctgcgcgg cggccgactt gtcgccgtcg tacctgatcc gcgcattcaa tgcgcgttac       660
     gggatgacgc cgcatgcatt cctgatcgat cggcgcgtgc agtacggccg caccgaattg       720
     cggcgtggca ggccgatcgc cgaagtcgcg ctcgacgccg gctttgcgga tcaggcgcat       780
     ttccagcgcg cgttccggcg gatcgcggcc gcgacgcccg ggcagtaccg cggcgcgatg       840
     cgctga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page