(data stored in ACNUC1104 zone)

EMBL: CP000959.PE528

CP000959.PE528       Location/Qualifiers
FT   CDS_pept        623638..624690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3717"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   bam:Bamb_5533 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3717"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92869"
FT                   /db_xref="GOA:B1K4F1"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4F1"
FT                   /protein_id="ACA92869.1"
FT                   /translation="MDSGQDHQKFFYFLLFAVTVGLCWILAPFSGAVFWGTILAILFQP
FT                   VQRWLAARFGKRRNLAALVTMSLIILIVILPLVFVTATLVQEIAYVYQELKDAQPNYSQ
FT                   YFHDIIHALPTSIQNLLQKYGLTNIPGIQKKLTDGAAQISQFAATQALSIGQNTFQFVV
FT                   SFGVMLYMVFFLLRDGGEIGRRVRRALPLDEEHKNLLLAKFTTVVRATVKGNIAVALVQ
FT                   GALGGLIFWILGIEGVVLWGALMAFLSLLPAIGASLVWVPAALYFLMIGAVWKCVILVA
FT                   FCVGVIGLVDNLLRPILVGKDTKMPDWVVLISTLGGMALFGINGFVIGPLVAALFMASW
FT                   DIYARSEQGE"
     atggatagcg gacaagacca ccaaaaattc ttctacttcc tgctgttcgc ggtcaccgtc        60
     ggactgtgct ggatcctcgc gccgttttcc ggcgccgtct tctggggcac cattctcgcg       120
     atcctgttcc agcccgtgca acgctggctc gccgcgcgct tcggcaagcg gcgcaacctg       180
     gccgcgctcg tcacgatgtc gctcatcatc ctgatcgtga tcctgccgct cgtgttcgtc       240
     acggccacgc tcgtgcagga aatcgcctac gtgtaccagg agctcaagga cgcgcagccg       300
     aattattcgc agtacttcca cgacatcatt cacgcgctgc cgacgtcgat ccagaacctg       360
     ctgcagaaat acgggttgac caacatcccg ggcatccaga agaagctgac cgacggcgcc       420
     gcgcagatca gccagttcgc ggccacccag gcgctcagca tcggccagaa cacgttccag       480
     ttcgtcgtga gcttcggcgt gatgctgtac atggtgttct tcctgctgcg cgacggcggc       540
     gagatcggcc gccgcgtgcg ccgtgcgctg ccgctcgacg aagagcacaa gaacctgctg       600
     ctcgcgaaat tcacgacggt cgtgcgcgcg acggtgaagg gcaacatcgc ggtcgcgctc       660
     gtgcaaggcg cgctcggcgg gttgatcttc tggatcctcg ggatcgaggg cgtggtgctg       720
     tggggtgcgc tgatggcgtt cctgtcgctg ctgccggcga tcggcgcgag cctcgtctgg       780
     gtgccggccg cgctctactt cctgatgatc ggtgcggtct ggaagtgcgt gatcctcgtc       840
     gcgttctgcg tcggcgtgat cggcctcgtc gataacctac tgcgcccgat cctcgtcggc       900
     aaggacacga agatgcccga ctgggtcgta ttgatctcga cgctcggcgg gatggcgctg       960
     ttcggcatca acggcttcgt gatcgggccg ctcgtcgccg cgctgttcat ggccagttgg      1020
     gacatctacg cacgctccga acagggcgaa tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page