(data stored in ACNUC1104 zone)

EMBL: CP000959.PE529

CP000959.PE529       Location/Qualifiers
FT   CDS_pept        complement(624734..625246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3718"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3718"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92870"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4F2"
FT                   /protein_id="ACA92870.1"
FT                   /translation="MRNNAKRSASVTAMSAGAVRKRVFGLGIVLAMSIAMSSAMAAGQP
FT                   ASDGVVRFTGSLVDLYDVTLDAPVGALVDAGQAADGGATATVRFDAHGRRLPGAQVALV
FT                   KPDGAAFAPDDGTAVRATWRDAHTERSMPLAPGRVHRVGPYGGVMTVAADEATGAVAPV
FT                   VIHIRHP"
     atgcggaaca acgcgaagcg atcggcatcg gtaacggcaa tgagcgccgg ggccgtgcgg        60
     aagagggtgt tcgggctcgg tatcgtgctc gcgatgtcga ttgccatgtc gagcgcgatg       120
     gcggccggac agcccgcatc ggatggcgtc gtgcggttca ccggctcgct cgtcgatctg       180
     tacgacgtga cgctcgatgc tccggtgggc gcgctcgttg acgcgggaca ggcggccgat       240
     ggcggggcaa cggccacggt ccggttcgat gcgcatggcc ggcgtttgcc gggtgcgcag       300
     gtcgcgctgg tgaagcccga cggtgcggcg ttcgcgccgg atgacggcac ggcggtgcgt       360
     gccacgtggc gcgatgcgca caccgagcga agtatgccgc tggcgccggg ccgggttcat       420
     cgcgtcggcc cgtatggcgg cgtgatgacg gtcgcggcgg atgaagcaac gggcgccgtg       480
     gcgcccgtcg tgattcatat ccgtcatcct tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page