(data stored in ACNUC1104 zone)

EMBL: CP000959.PE534

CP000959.PE534       Location/Qualifiers
FT   CDS_pept        complement(629693..630811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3723"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bam:Bamb_5527 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3723"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92875"
FT                   /db_xref="GOA:B1K4F7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4F7"
FT                   /protein_id="ACA92875.1"
FT                   /translation="MNAADQRWVVIYLSTGFSLAQAARLGEAFNLANRLHAYSADYQLK
FT                   YVSESGGLLQSSSGVRIAAEPFGDEHSRRARAFFHLHGERAAVNWDDALQRRLSDIRQH
FT                   ARWIVDAMELPALAATRRPSSSIDVRPGRAGRRATTTIELQAGETDVFAAALDMFRVDL
FT                   GDGAAQEIASNMMRPVEQRYAQSMWAFRELSASPSIRMSAQRLRAQSVNRISIANAAQA
FT                   AAMSERNFLRRFKKEIGVTPTEFVQHVRLERACHMLIHTTLPADKVARRTGFGSGERLA
FT                   KLFRQRLLMSPTEFRVAEREKILAHGAASPDPDERLAAACCDGDGADCDACVAARGKTG
FT                   RIPVKSTDRDLDSRFPCPSSPLPPPPLSARRK"
     gtgaatgcag cagatcagcg gtgggtcgtt atctatttga gtacggggtt ttcgttggcc        60
     caggccgcgc gcctcggcga agccttcaac ctggcgaatc gcctgcatgc gtacagcgcg       120
     gattaccagc tcaagtacgt atccgaaagc gggggactgt tgcagtcgtc gtccggcgtg       180
     cgcatcgcgg ccgagccgtt cggcgacgaa catagccgcc gtgcgcgcgc gttctttcat       240
     cttcatggcg agcgcgcggc cgtcaattgg gacgacgcat tgcagcggcg cctgtccgac       300
     attcgccagc atgcgcgctg gatcgtcgat gcgatggagt tgcccgcgct cgccgccacg       360
     cggcggccgt cgtcgtcaat cgacgtgcgg cccggccggg ccgggcgccg cgccaccacg       420
     acgatcgaat tgcaggccgg cgagaccgac gtgttcgccg ccgcgctcga catgtttcgc       480
     gtcgacctcg gcgacggcgc cgcgcaggag atcgccagca acatgatgcg gccggtcgag       540
     cagcgctacg cgcagtcgat gtgggcgttt cgcgaactga gcgcgagccc gtcgatccgg       600
     atgtccgcgc agcggttgcg tgcgcagagc gtgaaccgca tctcgatcgc gaacgccgcg       660
     caggcggccg cgatgagcga gcgcaatttc ctgcggcgct tcaagaagga aatcggcgtg       720
     acgccgaccg agttcgtcca gcacgtgcgg ctcgagcggg cgtgccacat gctgatccat       780
     acgacgctgc cggccgacaa ggtcgcgcgg cgcaccggct tcggcagcgg cgagcggctc       840
     gcgaagctgt ttcgtcagcg gctgttgatg tcgccgaccg aatttcgcgt cgccgagcgg       900
     gaaaagatcc tcgcgcacgg cgcggcgtcg cccgatcctg acgaacggct tgccgccgcg       960
     tgttgcgacg gcgacggggc ggattgcgac gcctgcgtgg ccgcgcgcgg gaaaacggga      1020
     cggatacccg taaaatcgac ggatcgcgat ctcgattccc ggtttccatg cccttcctcc      1080
     ccactaccgc caccgcccct ttctgcccgt cggaagtaa                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page