(data stored in ACNUC1104 zone)

EMBL: CP000959.PE536

CP000959.PE536       Location/Qualifiers
FT   CDS_pept        632274..632675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3725"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: bur:Bcep18194_B2297
FT                   OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3725"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92877"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4F9"
FT                   /protein_id="ACA92877.1"
FT                   /translation="MSLIHAAAVLDADAPDYVVQLQAGTHTLTGDEAPREGGQDRGPAP
FT                   YEFVLAGLAQCTAATLRMYMQRKTWPAARIAVRTELHADREGVQYVRRVVTLDGPLDDA
FT                   QRQRLTEICEKTPVTQFIKRGTRIETTLN"
     atgtcgctca tccacgccgc cgccgtcctc gatgccgatg cgcccgacta cgtcgtccag        60
     ttacaggccg gcacgcacac actgaccggc gacgaagcgc cgcgcgaagg cggccaggat       120
     cgcgggccgg cgccgtacga gttcgtgctc gccgggctcg cgcaatgcac ggccgcgacg       180
     ctgcgtatgt acatgcagcg caagacgtgg ccggccgcgc gcatcgcggt gcgcaccgaa       240
     ctgcatgccg atcgcgaagg cgtgcagtac gtgcgccgcg tcgtgacgct cgacggcccg       300
     ctcgacgacg cgcaacgcca gcgtctcacg gaaatctgcg agaaaacccc ggtgacgcag       360
     ttcatcaagc gcggcacgcg gatcgaaacg acgttgaact ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page