(data stored in ACNUC1104 zone)

EMBL: CP000959.PE540

CP000959.PE540       Location/Qualifiers
FT   CDS_pept        636810..637523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3729"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /note="TIGRFAM: riboflavin synthase, alpha subunit; PFAM:
FT                   Lumazine-binding protein; KEGG: bam:Bamb_5522 riboflavin
FT                   synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3729"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92881"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4G3"
FT                   /protein_id="ACA92881.1"
FT                   /translation="MFTGIVQGVGTIDAIKDHGELRTFSIAFPERFTDDIEIGASVSVD
FT                   GVCLTVTTIHSPVLIDFDVMLPSLRITTLADLATGARVNVERAAKDGAEIGGHPLSGHV
FT                   DFTGTIAHIASSEHNRMIRIGVPAEFKRYVFAKGYIAINGCSLTVSDVNRDEGWFDVWL
FT                   IPETRRATTFDAKGVDDKVNIEIERSTQVVVDTIRESVKETLGELNGVVTALLAEKGID
FT                   IEELLARNVARLPKQ"
     atgtttacag gcattgttca gggtgttggc accatcgacg ccatcaagga tcacggcgag        60
     ctgagaacgt tcagcatcgc attccccgag cggttcaccg acgatatcga gatcggcgcg       120
     agcgtgtcgg tcgacggcgt gtgcctgacc gtgacgacca tccattcacc ggtgctgatc       180
     gacttcgacg tgatgctgcc gagcctgcgg atcacgacgc tggccgacct cgcgaccggc       240
     gcgcgggtca acgtcgagcg ggccgcgaag gacggcgcgg agatcggcgg gcatccgctg       300
     tccggtcacg tcgatttcac ggggaccatc gcgcacatcg cgtcgtccga gcacaaccgg       360
     atgatccgca tcggcgtgcc ggccgagttc aagcgctatg tattcgcgaa aggctacatc       420
     gcgatcaacg gttgcagcct gaccgtgtcg gacgtcaatc gcgacgaagg ctggttcgac       480
     gtctggctga ttcccgaaac gcgccgcgcg accacgttcg atgcgaaggg cgtcgacgac       540
     aaggtcaaca tcgagatcga gcgcagcacg caggtcgtcg tggacacgat tcgcgaatcg       600
     gtcaaggaaa cgctcggcga attgaacggt gtcgtcaccg cgctgctggc ggaaaaaggc       660
     atcgatatcg aagaactgct ggcgcgcaac gtcgcgcggc tgccgaagca gtaa             714
//

If you have problems or comments...

PBIL Back to PBIL home page