(data stored in ACNUC1104 zone)

EMBL: CP000959.PE541

CP000959.PE541       Location/Qualifiers
FT   CDS_pept        complement(637542..638120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3730"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_5521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3730"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92882"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4V8"
FT                   /protein_id="ACA92882.1"
FT                   /translation="MTLDDFLTEAKRLARPSRQYRFADDGEPVTGYWHGVDAGALCISV
FT                   ERDGVWLNVCLDESGTSGRVETATQPVRSDRPLCRSDAMSLPSVDAVFRFGSAAIGAYL
FT                   DAHGWQRDWGFNGNFKGAAAHDYEREWMAQCPLYTGGVVAVAGGWNMPWPEDDELDDRE
FT                   LVLWTFEASEPWVEVFSDGSRYSVIQRIT"
     atgacactgg acgatttcct gaccgaagca aaacggcttg cgaggccgag ccgtcagtac        60
     cgcttcgcgg acgacggcga acccgtcacc ggctactggc atggggttga tgccggcgcg       120
     ttgtgtatct ccgtcgagcg cgacggcgtc tggctgaacg tgtgtctcga cgaaagcggc       180
     acgtcgggcc gcgtggagac tgccacgcaa cccgtccgtt ccgaccgccc gctgtgccga       240
     tccgatgcga tgtcgcttcc gtccgtcgac gcggtgttcc gcttcggctc cgccgcgatc       300
     ggcgcgtacc tcgacgcaca cggctggcag cgcgactggg gattcaacgg caacttcaag       360
     ggcgcggccg cgcacgacta cgagcgcgaa tggatggcgc aatgcccgct ctacacgggc       420
     ggcgtggtgg ccgtcgcggg cggatggaac atgccgtggc ccgaggacga cgaactcgac       480
     gatcgcgagc tcgtcctctg gacattcgag gcatcggaac cgtgggtcga ggtgttttcg       540
     gacggtagcc gttactcagt gatccagcgg atcacctag                              579
//

If you have problems or comments...

PBIL Back to PBIL home page