(data stored in ACNUC1104 zone)

EMBL: CP000959.PE544

CP000959.PE544       Location/Qualifiers
FT   CDS_pept        complement(640729..643038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3733"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: response regulator receiver; CheW domain
FT                   protein; ATP-binding region ATPase domain protein; Hpt
FT                   domain protein; KEGG: bur:Bcep18194_B2304 CheA signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3733"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92885"
FT                   /db_xref="GOA:B1K4W1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4W1"
FT                   /protein_id="ACA92885.1"
FT                   /translation="MSGDDDLSHLSLLELYREETRTQTQALSERLLALESGEPDAVALE
FT                   ACMRAAHSLKGAARIVGVPLGVEIAGRMEECFVAAQAGTIALTATHVDVLLAGVDLLVR
FT                   VGDPQGQPVSQTEIDVFAAALTGADGAQTMQAPAAAPPPVPPSFAPYRDHDGAANEPVG
FT                   ASAAVPPLAVSGAVPHPAQAGRVSGAGAMRRVRADTLNRLLSLSGESLVESRWLKPFAE
FT                   SMLRVKRAQRDAARSLDLMVEQFADDLDAGMLASMNEVRHMLNDLQRSLAERMDEFDRF
FT                   ERRSTHIAEQLYDEALQCRMRPFGDATRAYPRIVRDLARSLGKQVRFSIVGEGTQVDRD
FT                   ILDLLDAPLGHLLRNAIDHGVDSPDARHARGKPAEASVTLEARHSAGSLLVSVIDDGPG
FT                   VDMDALRAAVVRQRLTDDETAARLSDPELLEFLLLPGFSMRDAVTDVSGRGVGLDAVQE
FT                   MVRGVRGAVRIFNEPGAGMRFVLQLPLTLSVIRSLLVEVGGEPYAFPLAHVRRTLELAH
FT                   DDIDVLEGQPHFPFDGRRVGLVAAHQLLDAGEPDVARASTAVVVVGGEPELYGVAVDRF
FT                   LGERMLVVQPLDSRLHKIQNIAAGALLENGDPVLIVDVEDLIRSVDKLVRGGQLARLTR
FT                   DPQLALADRRRRVLVVDDSLTVRELERKLLEKRGYDVTVAVDGMEGWNAVRSDAFDLVV
FT                   TDVDMPRMDGIELVTLIKGDPMLKRVPVMIVSYKDRDEDRRRGLDAGADYYLAKSSFHD
FT                   EALLDAVHDLIGDARG"
     atgagcggcg atgacgacct gagccacctg tcgctgctcg agctgtatcg cgaggagacg        60
     cgcacgcaga cccaggcgct gtcggagcgg ctgctcgcgc tcgaatcggg cgagcccgat       120
     gccgtcgcgc tcgaagcgtg catgcgcgcc gcgcactcgc tgaagggcgc cgcgcgtatc       180
     gtcggcgtgc cgctcggcgt cgagatcgcc gggcggatgg aagaatgctt cgtcgccgcg       240
     caggccggca cgatcgcgct gacggccacg cacgtcgacg tgctgctggc cggcgtcgat       300
     ttgctggtgc gggtcggcga tccgcagggg cagcccgtgt cgcagaccga gatcgacgtg       360
     ttcgcggcgg cgctgacggg cgccgacggc gcgcagacga tgcaggcacc ggccgccgcg       420
     ccaccgcccg tgccgccgtc gttcgcgccg tatcgcgatc acgacggcgc cgcgaacgag       480
     ccggtcgggg cgagcgccgc ggtgccgccg ctcgccgtgt cgggcgcggt gccccatccg       540
     gcccaggctg gccgcgtgtc gggcgccggc gcgatgcgcc gcgtgcgcgc cgatacgctg       600
     aaccggctgc tgagcctgtc cggcgaatcg ctggtggaat cgcgctggct caagccgttc       660
     gccgaatcga tgctgcgcgt gaagcgcgcg cagcgcgacg cggcccgttc gctcgacctg       720
     atggtcgagc agttcgccga cgatctcgac gcgggcatgc tcgcatcgat gaacgaagtg       780
     cggcacatgc tcaacgacct gcagcgctcg cttgccgagc gcatggacga attcgaccgc       840
     ttcgagcggc gcagcacgca tatcgccgag cagctgtacg acgaggcgct gcaatgccga       900
     atgcggccgt tcggcgatgc gacgcgtgcg tatccgcgca tcgtccgcga cctcgcgcgc       960
     tcgctcggca agcaggtgcg tttctcgatc gtcggtgaag gcacgcaggt cgatcgcgac      1020
     atcctcgacc tgctcgacgc gccgctcggc cacctgctgc gcaacgcgat cgaccacggc      1080
     gtcgattcgc ccgacgcgcg ccacgcgcgc ggcaagccgg ccgaggcgag cgtcacgctc      1140
     gaggcgcgcc acagcgccgg ctcgctgctc gtcagcgtga tcgacgacgg gccgggggtc      1200
     gacatggatg cgctgcgcgc ggccgtcgtg cgccagcgcc tgaccgacga cgagacggcc      1260
     gcgcggctgt ctgatccgga attgctcgaa ttcctgctgc tgccgggctt ctcgatgcgc      1320
     gatgcggtga ccgacgtatc gggccgcggc gtcggtctcg acgcggtgca ggagatggtg      1380
     cgcggcgtgc gtggcgcggt gcggatcttc aacgagccgg gggccggcat gcgcttcgtg      1440
     ctgcagttgc cgctcacgct gtcggtgatc cgcagcctgc tcgtcgaagt gggcggcgag      1500
     ccctatgcat tcccgctcgc gcacgtgcgc cgcacgctcg aactcgcgca cgacgacatc      1560
     gacgtgctcg aagggcagcc gcattttccg ttcgacggcc ggcgcgtggg cctcgtcgcc      1620
     gcgcaccagc tgctcgatgc gggcgaaccc gacgtggcgc gcgcgagcac ggcggtcgtg      1680
     gtcgtcggcg gcgagccgga gctgtacggc gtcgcggtcg accgcttcct cggcgagcgg      1740
     atgctcgtcg tgcagccgct cgacagccgc ctgcacaaga tccagaacat cgcggccggc      1800
     gcgttgctcg agaacggcga cccggtgctg atcgtcgacg tcgaggacct gatccgctcg      1860
     gtcgacaagc tcgtgcgcgg cggccagctc gcgcggctca cgcgcgatcc gcagctcgcg      1920
     ctcgccgacc ggcgccgccg cgtgctcgtc gtcgacgatt cgctgacggt gcgcgagctc      1980
     gaacgcaagc tgctggaaaa gcgcggctac gacgtgacgg tcgcggtcga cgggatggaa      2040
     gggtggaacg cggtgcgcag cgatgcgttc gatctcgtcg tgaccgacgt cgacatgccg      2100
     cgcatggacg gcatcgaact cgtcacgctg atcaagggcg acccgatgct caagcgcgtg      2160
     ccggtgatga tcgtgtcgta caaggatcgt gacgaggatc gccgccgcgg gctcgacgcc      2220
     ggcgccgatt actacctcgc gaagagcagc ttccacgacg aggcgctgct cgatgccgtg      2280
     cacgacctga tcggagatgc gcgcggatga                                       2310
//

If you have problems or comments...

PBIL Back to PBIL home page