(data stored in ACNUC1104 zone)

EMBL: CP000959.PE546

CP000959.PE546       Location/Qualifiers
FT   CDS_pept        complement(644207..645619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3735"
FT                   /product="MCP methyltransferase, CheR-type with Tpr
FT                   repeats"
FT                   /EC_number="2.1.1.80"
FT                   /note="PFAM: MCP methyltransferase CheR-type;
FT                   Tetratricopeptide TPR_2 repeat protein; KEGG:
FT                   bur:Bcep18194_B2306 MCP methyltransferase, CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3735"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92887"
FT                   /db_xref="GOA:B1K4W3"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4W3"
FT                   /protein_id="ACA92887.1"
FT                   /translation="MSESRFRGWLLRETGIDPDSLGNDFLMRALADRVHALQADGERVP
FT                   AAARPPVTPEALDAYWQQLNASADERRALIELFVVPETWFFRDREAFATLARLAAERLA
FT                   AMPGRVIRVLSAPCSTGEEPYSAAMALLDAGLEPASFTIDAIDLSARAIEQARLGCYGR
FT                   NAFRGTATEFRTRYFTPTRDGWLLDERVRACVQFSHANLVEPVADTGIRYDFVFCRNVL
FT                   IYFDRDAQDRVIRSLDARLADDGMLFVGPAETGVAMRHGMRSARVPLAFAFHREPAGAA
FT                   ADACAARPAAPLSAAAPYPGAERFTVAPLAAPRPVLAVAPPAWLGDVRQPFAVPLPAVT
FT                   TAAIDARADLAVAAAAAAAPANDGIAPTLDEAPTLEDAQALANAGALDEAERVLAQFSA
FT                   RVGPHADAFYLNGLIADARGRAAEASDFYRKALYLRPTHHEALTHLATLLDVGGDRAGA
FT                   QWLLERARRSAG"
     atgtccgaat cgcgatttcg cggctggttg ctgcgcgaga ccggcatcga ccccgattcg        60
     ctcggcaacg atttcctgat gcgggcgctg gcggatcgcg tgcatgcgtt gcaggcggac       120
     ggcgagcgcg tgccggcggc cgcgcggccg cccgtgacgc cggaagcgct cgacgcgtac       180
     tggcagcagc tcaacgcgtc ggccgacgaa cggcgcgcgc tgatcgagct gttcgtcgtc       240
     cccgagacgt ggttcttccg cgaccgcgag gccttcgcga cgctcgcgcg gctggccgcc       300
     gaacggctcg ccgcgatgcc gggccgcgtg atccgcgtac tgagcgcgcc gtgttcgacg       360
     ggcgaggaac cgtattcggc ggcgatggca ttgctggatg cggggctcga accggccagc       420
     ttcacgatcg acgcgatcga cctcagtgcg cgtgcgatcg agcaggcgcg gctcggctgt       480
     tacgggcgca atgcgttccg cgggacggcg acggagtttc gtacgcggta tttcacgccg       540
     acccgcgacg gctggctgct cgacgagcgc gtgcgcgcgt gcgtgcagtt cagtcatgcg       600
     aacctcgtcg aaccggtggc cgataccggc attcgctacg acttcgtgtt ctgccgcaac       660
     gtactgatct atttcgaccg cgatgcgcag gatcgcgtga tccgctcgct cgacgcgcgt       720
     ctcgccgacg acggcatgct gttcgtcggg ccggcggaga cgggcgtcgc gatgcggcac       780
     gggatgcgct cggcgcgcgt gccgctggcg ttcgcgtttc atcgcgagcc ggccggcgcg       840
     gcggccgacg cctgcgcggc gcggccggcg gcgccgctgt ccgcggcggc gccttacccg       900
     ggcgcggagc gcttcacggt tgcgccgctc gccgcgccgc ggccggtgct ggccgtcgcg       960
     ccgccggcct ggctcggcga cgtgcgtcag ccgtttgcgg tgccgctgcc ggccgtgacg      1020
     acggctgcga tcgacgcacg ggccgacctg gcggtggccg ccgccgcggc ggccgcaccc      1080
     gccaacgacg gtatcgcgcc gacgctcgac gaggcaccga cgctggagga tgcgcaggcg      1140
     ctggcgaacg cgggcgcgct cgacgaggcc gagcgcgtgc tcgcgcagtt ctcggcgcgc      1200
     gtcggcccgc atgccgatgc gttctacctg aacggactga tcgcggatgc gcgcgggcgc      1260
     gccgcggaag cgagcgactt ctaccgcaag gcgctgtact tgcgccccac gcatcacgag      1320
     gcgctgacgc atctcgcgac gctgctcgac gtcggcggcg atcgcgcggg cgcgcaatgg      1380
     ctgctcgaac gcgcccggcg ttcggccggc tga                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page