(data stored in ACNUC1104 zone)

EMBL: CP000959.PE548

CP000959.PE548       Location/Qualifiers
FT   CDS_pept        complement(646131..647807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3737"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: bur:Bcep18194_B2308
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3737"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92889"
FT                   /db_xref="GOA:B1K4W5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4W5"
FT                   /protein_id="ACA92889.1"
FT                   /translation="MATVTPRATNESLHPTIGAARLTLGNRILLSFGVLFVLMLVTAGV
FT                   SYERLRAINAEAVSIERDSLPGVYLASSLRAAVNETFVMLQQATFVETDPDAVQRDLAK
FT                   ISDATKQVESLSVDYQASIFRDDDRARFATFRGAYDRYLPLLTDAVQRHRGSRDEAIAA
FT                   YAKVLPGWAEVVQDANIMVQENRKFADQSARVIRESVQDTEVVLVGALTIMLLSALGLG
FT                   YMLYRSVTVPMARLVEVHDVMRTGNLTHRLDLRRRDEFGTLETGFNRMADELTELVARA
FT                   QQSSMQVTTSVAEIAATSREQQATANETAATTTEIGATSREIFATSRDLLRTMNEVAGV
FT                   AEQSATLAGVSQSGLTRMGETMRSVMDAAGSVNAKLAILNEKALNINQVVATITKVADQ
FT                   TNLLSLNAAIEAEKAGEYGRGFAVVATEIRRLADQTAVATYDIEQTVKEIQSAVSAGVM
FT                   GMDKFSEEVRRGMLDVQQVGGQLSQIIAEVQTLAPRFQMVNEGMQTQANGAEQITQALS
FT                   QLSEAAQQTAESLRQSSQAIDDLTLVANQLRTSVSRFKVDA"
     atggccaccg tgacgccccg cgcgaccaat gaaagcctgc atccgaccat cggcgctgcc        60
     cggctgacgc tcggcaatcg catcctgctc agcttcggcg tgctgttcgt gctgatgctg       120
     gtgacagccg gcgtgtcgta cgagcgactg cgcgcgatca acgccgaagc cgtcagcatc       180
     gagcgcgact cgctgcccgg cgtctacctc gcgtcatcgc tgcgcgcggc ggtcaacgaa       240
     acgttcgtca tgctgcagca ggcgaccttc gtcgagaccg accccgacgc cgtgcagcgc       300
     gatctcgcga agatctcgga cgcgacgaag caggtcgagt cgctgtcggt cgactaccag       360
     gcgtcgatct tccgcgacga cgaccgcgcg cgttttgcga cgtttcgcgg cgcatacgat       420
     cgctacctgc cgctgttgac cgacgcggta cagaggcacc gcggctcgcg cgacgaagcg       480
     atcgccgcct acgcgaaggt gttgccgggg tgggccgagg tcgtgcagga cgcgaacatc       540
     atggtccagg agaaccgcaa gttcgcggac cagtccgcga gggtgatccg cgaatccgtg       600
     caggacacgg aagtcgtgct cgtcggtgcg ctgacgatca tgctgctgtc cgcgctcggg       660
     ctcggctaca tgctgtaccg ctcggtcact gtaccgatgg cgcggctcgt cgaggtgcac       720
     gacgtgatgc gcaccggcaa cctgacccat cgcctcgatc tgcgccgccg cgacgaattc       780
     ggcacgctcg agaccggctt caaccggatg gccgacgaat tgaccgagct ggtcgcgcgc       840
     gcgcagcagt cgtcgatgca ggtgacgacg tcggtggccg agatcgcggc gacgtcgcgc       900
     gaacagcagg cgaccgcgaa cgagaccgcg gcgacgacga ccgagatcgg cgcgacctcg       960
     cgcgagatct tcgcgacgtc gcgcgacctg ctgcgcacga tgaacgaagt ggccggcgtg      1020
     gccgagcagt cggcgacgct cgcgggcgtg agccagagcg ggctcacgcg gatgggcgag      1080
     acgatgcgca gcgtgatgga cgcggctggc tcggtgaacg cgaagctcgc gatcctcaac      1140
     gagaaggcgc tgaacatcaa ccaggtggtc gcgacgatca ccaaggtggc cgaccagacc      1200
     aacctgctgt cgctgaacgc ggcgatcgag gccgagaagg ccggcgagta cggtcgcggc      1260
     tttgcggtcg tcgcgaccga gatccgccgc ctggccgacc agacggcggt ggcgacctac      1320
     gacatcgagc agacggtcaa ggaaatccag tcggccgtgt cggcgggcgt gatggggatg      1380
     gacaagttct ccgaggaagt gcgccgcggg atgctcgacg tgcagcaggt cggcgggcag      1440
     ctgtcgcaga tcatcgccga ggtgcagacg ctcgcgccgc gcttccagat ggtcaacgaa      1500
     gggatgcaga cgcaggcgaa cggcgccgag cagatcacgc aggcgctgtc gcaactgtcg      1560
     gaagccgcgc agcagacggc cgagtcgctg cgccagtcgt cgcaggcgat cgacgacctg      1620
     acgctcgtcg cgaaccagct gcgcaccagc gtgtcgcgct tcaaggtcga cgcgtga         1677
//

If you have problems or comments...

PBIL Back to PBIL home page