(data stored in ACNUC1104 zone)

EMBL: CP000959.PE55

CP000959.PE55        Location/Qualifiers
FT   CDS_pept        64208..64762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3240"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpl:BURPS1106A_0386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3240"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92396"
FT                   /db_xref="InterPro:IPR021087"
FT                   /db_xref="InterPro:IPR038712"
FT                   /db_xref="UniProtKB/TrEMBL:B1K8P9"
FT                   /protein_id="ACA92396.1"
FT                   /translation="MTADLGSLTRDTTAQQIDILAVIDTEYIKLRYPHPSKQPELPIAV
FT                   DHRAVRLLYTGARGASIGNGPADPVLTLYPGDTVSLRAVSLYENAEDAVLIYQVSHLFG
FT                   QQVFNPFSQDFLDVNAVQLNPETRDGLPPLTKPQTLVSIGAKARESGIETLGACFGLYT
FT                   LERSTQELLGYYWWDWFVTCS"
     atgacagccg atcttggaag cctcactcgc gacacgaccg cgcagcaaat cgacatcctc        60
     gccgtcatcg acacggaata tatcaagctg aggtacccgc atccgagcaa gcagcccgaa       120
     ttaccgatcg ccgtcgatca tcgcgccgtg cgcctgcttt acaccggcgc gcgcggcgcg       180
     tcgatcggaa atggcccggc ggaccccgtt ctgacgctgt atcccggcga cacggtttcg       240
     ctcagggcag tctccctcta tgaaaacgcg gaagacgcgg tgctgattta tcaggtttcg       300
     cacctgttcg gccagcaagt tttcaatccg ttttcgcagg acttcctcga cgtgaacgcc       360
     gtgcaactga accccgaaac gcgcgacggc ctgccgccgc tgacgaagcc gcaaacgttg       420
     gtcagcatcg gcgccaaggc gagagagagc gggatcgaaa cgctcggcgc ctgcttcggg       480
     ctctatacgc tggaacgaag tacccaggag ttgttgggat actactggtg ggactggttc       540
     gtcacgtgtt cgtga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page