(data stored in ACNUC1104 zone)

EMBL: CP000959.PE553

CP000959.PE553       Location/Qualifiers
FT   CDS_pept        654839..655177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3742"
FT                   /product="addiction module killer protein"
FT                   /note="TIGRFAM: addiction module killer protein; PFAM:
FT                   protein of unknown function DUF891; KEGG:
FT                   bur:Bcep18194_B2313 protein of unknown function DUF891"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3742"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92894"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4X0"
FT                   /protein_id="ACA92894.1"
FT                   /translation="MVDILQSVPYSAPTFSIRTTDVFEAWFAGLPDRVARRRIQARIDR
FT                   LSMGNPGDWKSAGSPVVEMRIDHGPGYRVYYVRRGTIWVILLCGGDKSTQQADIRAAHA
FT                   MLAHLDME"
     atggttgaca tcctgcaatc cgtgccctac agtgcgccta cgttcagcat ccggaccacc        60
     gacgtcttcg aagcgtggtt cgccggcctg ccggatcgcg tcgcgcggcg gcgcatccag       120
     gcgcgcatcg accgtctgtc gatgggcaat ccgggcgact ggaaatccgc cggctccccc       180
     gtcgtcgaaa tgcgtatcga ccacggcccc ggctatcgcg tctattacgt gaggcgcgga       240
     acgatatggg tcatcctgct ctgcggcggc gataagtcga cgcaacaggc cgacatccgc       300
     gccgcgcacg caatgctcgc gcacctcgac atggagtga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page