(data stored in ACNUC1104 zone)

EMBL: CP000959.PE554

CP000959.PE554       Location/Qualifiers
FT   CDS_pept        655181..655480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3743"
FT                   /product="putative transcriptional regulator"
FT                   /note="TIGRFAM: addiction module antidote protein; KEGG:
FT                   bam:Bamb_5507 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3743"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92895"
FT                   /db_xref="GOA:B1K4X1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4X1"
FT                   /protein_id="ACA92895.1"
FT                   /translation="MDKIKTRPWDSAEHLKTEDDMADYFDACLQEAGDDPAFIAHALGV
FT                   IARARGMSQVARDAGLSREGLYKALSHDGNPSFGTILKVIKALGLQLHGAKAAA"
     atggacaaga tcaagacgcg gccgtgggat tcggccgaac acctgaaaac cgaagacgac        60
     atggccgact acttcgacgc ctgcctgcag gaggccggcg acgatccggc cttcatcgcg       120
     catgcgctcg gcgtgatcgc ccgtgcccgc ggcatgtcgc aggtcgcccg cgatgcgggc       180
     ctgtcgcgcg aagggctgta caaggcgctg tcgcacgacg gcaatccgag cttcggcacg       240
     atcctgaagg tcatcaaggc gctcggcctg caattgcacg gcgccaaggc tgccgcgtga       300
//

If you have problems or comments...

PBIL Back to PBIL home page