(data stored in ACNUC1104 zone)

EMBL: CP000959.PE555

CP000959.PE555       Location/Qualifiers
FT   CDS_pept        complement(655529..656815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3744"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   bur:Bcep18194_B2315 protein of unknown function DUF445"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3744"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92896"
FT                   /db_xref="GOA:B1K4X2"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4X2"
FT                   /protein_id="ACA92896.1"
FT                   /translation="MTPDKALELKRSKRRALWLLLAAVAVFVTTILLPRGPWVDGFKAV
FT                   AEAAMVGALADWFAVVALFRRVPIPFVSRHTEIIPKNKDKIADNLAVFVREKFLGPDAL
FT                   AAQIRQHDPAQKLGAWLGEPANTDALGGYVTKLMSFALDMTDDARIQSFVHDAFRAVID
FT                   RVDLSQSAGAILDTLTKDGRHQALLDDAIEQVVDVLGKEENREVIAGFIVEWLKTQYPK
FT                   VEKIMPTQWFGENGARMLASAVSRVLEGVAADPEHELRQRFDRTVVRLTERLKHDPAFI
FT                   AKGEEIKRYIRDGDAFNEYARDLWDQLRAWLKADLARPDSALHRQAATLGGWLGARLAG
FT                   SPALRASLNEHVERAVHEMAPDFADFLMRHIRDTVRNWDAREMSRQIELNIGKDLQYIR
FT                   INGTLVGGLIGLGLYLVSLVPRWAAGWLH"
     atgacgccag acaaagctct cgaactgaaa cgcagcaagc gccgcgcgct atggctgctc        60
     ctggccgccg tcgcggtgtt cgtcaccacc atcctgctgc cgcgcggccc gtgggtcgac       120
     ggtttcaagg ccgtcgccga agccgcgatg gtcggtgcgc tcgccgactg gttcgcggtc       180
     gtcgcgctgt tccgtcgcgt accgatcccg ttcgtgtcgc gccataccga gatcattccg       240
     aagaacaagg acaagatcgc cgacaacctc gcggtattcg tgcgcgagaa attcctcggc       300
     cccgacgcgc tcgccgcgca gatccgccag cacgatcccg cgcagaagct cggcgcgtgg       360
     ctcggcgagc cggcgaacac cgacgccctc ggcggctacg tgacgaagct gatgagcttc       420
     gcgctcgaca tgaccgacga cgcgcgaatc cagtcgttcg tccacgatgc attccgcgcg       480
     gtgatcgacc gggtcgacct gtcgcaatcg gccggcgcga tcctcgacac gctgacgaag       540
     gacggccgcc accaggcgct gctcgacgac gcgatcgaac aggtggtcga tgtgctcggc       600
     aaggaagaga accgcgaggt gatcgcgggc ttcatcgtcg aatggctgaa gacgcaatac       660
     ccgaaggtcg agaagatcat gccgacgcag tggttcggcg agaacggcgc gcgcatgctc       720
     gcgagcgcgg tgagccgcgt gctcgaaggc gtggcggccg accccgagca cgaactgcgg       780
     caacgcttcg accggacggt cgtgcggctg accgagcggc tgaagcacga ccctgcgttc       840
     atcgcgaagg gcgaggagat caagcgctat attcgcgacg gcgacgcgtt caacgagtat       900
     gcacgcgact tgtgggacca gttgcgtgcg tggctgaagg cggatctcgc ccgccccgat       960
     tcggcgctgc accggcaggc cgcgacgctg ggcggctggc tcggcgcgcg gctcgccggg      1020
     agcccggcgc tgcgtgcgtc gctgaacgag catgtggagc gggccgtgca cgagatggcg      1080
     cccgatttcg ccgatttcct gatgcgccac attcgcgaca cggtgcgcaa ctgggacgcg      1140
     cgcgagatgt cgcgacagat cgagctgaac atcggcaagg atctgcaata catccggatc      1200
     aacggcacgc tggtcggcgg gctgatcggg ctcgggttgt atctggtgtc gctggtgccg      1260
     cgctgggcgg ccgggtggct gcactga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page