(data stored in ACNUC1104 zone)

EMBL: CP000959.PE557

CP000959.PE557       Location/Qualifiers
FT   CDS_pept        complement(658177..658503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3746"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   bur:Bcep18194_B2323 Rieske (2Fe-2S) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3746"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92898"
FT                   /db_xref="GOA:B1K4X4"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4X4"
FT                   /protein_id="ACA92898.1"
FT                   /translation="MTEATLAEWHPLGAFDEFSEDEPAARVAGQKPIAVFRIGDELFAM
FT                   HDLCTHGHARLSEGYVEDGCVECPLHQGLIDIRTGAPKCAPITEPVRTYPIRIVDGQVE
FT                   VNVG"
     atgaccgaag caacgctggc cgagtggcat ccgctcggcg ctttcgacga attctccgaa        60
     gacgaaccgg cggcgcgcgt cgccggccag aagccgatcg ccgtgttccg gatcggcgac       120
     gaactgttcg cgatgcacga cctctgcacg cacggccatg cgcggctgtc cgaaggctat       180
     gtggaggacg gctgcgtcga atgcccgctg caccaggggc tgatcgacat tcgcaccggc       240
     gcgccgaaat gcgcgccgat caccgagccg gtgcggacct atccgatccg gatcgtcgac       300
     ggacaggtgg aagtcaatgt cggctga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page