(data stored in ACNUC1104 zone)

EMBL: CP000959.PE560

CP000959.PE560       Location/Qualifiers
FT   CDS_pept        660514..661473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3749"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bur:Bcep18194_B2326 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3749"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92901"
FT                   /db_xref="GOA:B1K4X7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4X7"
FT                   /protein_id="ACA92901.1"
FT                   /translation="MSPTSFEPLALRAHRLFESRDLDETRERISRVMQPHALLPSGRVR
FT                   GASHMDFVRLGGLGIGTIAFGDAMRVQVDAVDGYYLLMFCLSGQAEVRAMGRQLGVDGQ
FT                   TGVLCAPGERFDAVLSADCEQFVLRIDAATVGALTGDPRAMLDPVLHVSDAALAAWRQQ
FT                   LMLVARSPELLERANANPRVASQLEHLLIDLLIEGHPPSVLQAAHRDPAPGFVRRAQEF
FT                   VDAHYAQPLQLADIVQAANVPERTLRDAFLQFRGMSPMQYLRATRLAHARELLRGAASD
FT                   RRIADIALDCGFTHLGRFAIAYREKFGESPSETLDARR"
     atgtccccaa cgtcgttcga gccgctcgcg ctgcgcgcgc accggctgtt cgaatcccgc        60
     gatctcgacg agacgcgcga gcggatctcg cgcgtgatgc agccgcacgc gctgctgccg       120
     agcggccgcg tgcggggtgc gtcgcacatg gatttcgtca ggctgggcgg gctcgggatc       180
     ggcacgatcg cgttcggcga cgcgatgcgc gtgcaggtcg atgccgtcga cggctactac       240
     ctgctgatgt tctgcctgtc cggccaggcc gaagtgcgcg cgatggggcg gcaactcggc       300
     gtcgatggcc agaccggcgt gctgtgcgcg cctggcgagc gcttcgacgc ggtgctgtcg       360
     gccgattgcg agcagttcgt gctgcgcatc gacgcggcga ccgtcggcgc gctgaccggc       420
     gacccgcgcg cgatgctcga ccccgtgctg cacgtgagcg acgccgcact cgccgcgtgg       480
     cgccagcagt tgatgctcgt cgcgcggtcg cccgagctgc tcgaacgtgc gaacgcgaac       540
     ccgcgggtcg cgtcgcaact cgagcatctg ctgatcgacc tgctgatcga aggccatccg       600
     ccgtcggtgc tgcaggcggc gcaccgcgac ccggcgccgg gtttcgtgcg gcgcgcgcag       660
     gagttcgtcg atgcgcacta cgcgcagccg ctgcagctcg ccgatatcgt ccaggccgcc       720
     aacgtgcccg aacggacgct gcgcgatgcg ttcctgcaat tccgcgggat gagcccgatg       780
     caatacctgc gcgcgacgcg gctcgcgcac gcacgcgaac tgctgcgcgg cgcggcatcc       840
     gaccggcgga tcgccgatat cgcgctcgat tgcgggttta cccacctggg ccggttcgcg       900
     atcgcgtatc gggagaagtt cggcgaatcg ccgtcggaaa cgctcgacgc caggcgctga       960
//

If you have problems or comments...

PBIL Back to PBIL home page