(data stored in ACNUC1104 zone)

EMBL: CP000959.PE563

CP000959.PE563       Location/Qualifiers
FT   CDS_pept        complement(663840..664730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3752"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bur:Bcep18194_B2327
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3752"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92904"
FT                   /db_xref="GOA:B1K4Y0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4Y0"
FT                   /protein_id="ACA92904.1"
FT                   /translation="MELRQLRYFIAVAEEMNITRAAERLHMTQPPLSRQLQAIEEEIGL
FT                   PLFERGARPLKLTDAGRVFYAQAKRLVDQADELGPLTRRLAQLSERIVIGFVPSALYGA
FT                   LPDVIRAFREAQPDVELSLIEMFTLEQLGALKGGRIDVGFGRLRFDDDQLVREALIEEK
FT                   LIAALPAGHRLADPARPLTLADLANETMIVYPSTPRPSFADQQLSALRDGAVVPAAVHE
FT                   VRELQTALGLVAAQVGVSLVPESVEGVRVKGVVYRRLPEPGATSPIIMSRRLHGESAAT
FT                   AAFCAIAREMIVPAA"
     atggaattgc gtcagctccg ttacttcatc gccgtcgccg aggaaatgaa catcacgcgg        60
     gcggcggagc ggctgcacat gacgcagccg ccgctgagcc gccagctcca ggcgatcgag       120
     gaggagatcg ggctgccgct gttcgagcgc ggcgcgcggc cgctgaaact gaccgatgcc       180
     gggcgcgtgt tctatgcgca ggcgaaacgt ctggtcgacc aggccgacga gctggggccg       240
     ctcacgcggc ggctcgcgca actgtcggag cggatcgtga tcggcttcgt gccgtcggcg       300
     ctgtacggcg cgctgccgga cgtgatccgt gcgtttcgcg aggcgcagcc ggacgtcgag       360
     ctgtcgctga tcgaaatgtt cacgctcgaa cagcttggcg cgctgaaggg cgggcggatc       420
     gacgtggggt tcggccgcct gcgcttcgac gacgaccagc tggtgcgcga ggcgctgatc       480
     gaggaaaagc tgatcgcggc gctgccggcc gggcatcggc tcgccgatcc ggcccggccg       540
     ctgacgctcg cggatctcgc gaacgagacg atgatcgtgt acccgagcac gccgcggccg       600
     agcttcgccg atcagcagtt gtcggcgctg cgcgacggcg cggtcgtgcc ggcggccgtg       660
     cacgaggtgc gcgagctgca gacggcgctc gggctcgtgg ccgcgcaggt gggcgtgtcg       720
     ctggtgccgg agagcgtgga gggcgtgcgc gtgaagggcg tcgtctaccg gcggctgccg       780
     gagccgggcg cgacgtcgcc gatcatcatg agccgccggc tgcacggcga aagcgcggcc       840
     acggccgcgt tttgcgcgat tgcgcgggag atgatcgtgc cggctgcgtg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page