(data stored in ACNUC1104 zone)

EMBL: CP000959.PE565

CP000959.PE565       Location/Qualifiers
FT   CDS_pept        665988..666890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3754"
FT                   /product="catechol 1,2-dioxygenase"
FT                   /note="TIGRFAM: catechol 1,2-dioxygenase; PFAM: intradiol
FT                   ring-cleavage dioxygenase; Catechol dioxygenase domain
FT                   protein; KEGG: bam:Bamb_5498 catechol 1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3754"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92906"
FT                   /db_xref="GOA:B1K4Y2"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR012801"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4Y2"
FT                   /protein_id="ACA92906.1"
FT                   /translation="MNKQAIDALLKTFDDAAEKPGNPRVRAIVNRIVKDICYTIEDFDV
FT                   QPSEFWTALNYLNEAGREFGLIAAGLGLERFLDVRMDEAEAKAGIQGGTPRTIEGPLYV
FT                   AGAPESVGHARLDDGTDPGQTLIMRGRVLGQDGAPLANALVEVWHANHLGNYSYFDASQ
FT                   PAFNLRRSIRTDAEGRYSFRSVLPVGYSVPPGSKTEQLLDQLGRHGHRPAHIHFFVSAD
FT                   GYRKLTTQINIDGDPHLWDDFAFATRDGLIPPVRQAEGAEGKPYGVDGQFALIDFDFSL
FT                   LKDKQDVPGSEVERARAQA"
     atgaacaagc aagccatcga cgccctgctg aagaccttcg acgacgccgc cgagaagccc        60
     ggcaacccgc gcgtgcgcgc gatcgtcaac cggatcgtga aggacatctg ctacacgatc       120
     gaggacttcg acgtgcagcc gagcgaattc tggacggccc tgaactacct gaacgaagcc       180
     ggccgcgaat tcgggctgat cgccgcgggc ctcggcctcg aacgatttct cgacgtgcgg       240
     atggacgaag ccgaggcaaa ggcaggcatc cagggcggca cgccgcgcac gatcgaaggg       300
     ccgctgtacg tcgccggcgc gccggaatcg gtcggccacg cgcggctcga cgacggcacc       360
     gatccgggcc agacgctgat catgcgcggc cgggtgctcg gccaggacgg cgcgccgctc       420
     gcgaacgcgc tggtcgaggt gtggcatgcg aaccatctgg gcaattactc gtacttcgac       480
     gcgtcgcagc ccgcgttcaa cctgcgccgc tcgatccgca ccgatgccga aggccgctac       540
     agcttccgca gcgtgctgcc ggtcggctac agcgtgccgc cgggcagcaa gaccgagcaa       600
     ctgctcgacc agctcggccg ccacggccat cgtccggcgc acatccactt cttcgtttcg       660
     gcggacggtt atcgtaagct gacgacgcag atcaacatcg atggcgatcc gcatctgtgg       720
     gacgacttcg cattcgcgac gcgcgacggg ctgatcccgc cggtcaggca ggcggagggc       780
     gcggaaggca agccgtacgg cgtcgacggg cagttcgcgc tgatcgactt cgacttctcg       840
     ctgctcaagg acaagcagga cgtgccgggc agcgaagtcg agcgggcccg cgcgcaggcg       900
     tga                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page