(data stored in ACNUC1104 zone)

EMBL: CP000959.PE569

CP000959.PE569       Location/Qualifiers
FT   CDS_pept        669327..669731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bcenmc03_3758"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bcenmc03_3758"
FT                   /db_xref="EnsemblGenomes-Tr:ACA92910"
FT                   /db_xref="InterPro:IPR018894"
FT                   /db_xref="UniProtKB/TrEMBL:B1K4Y6"
FT                   /protein_id="ACA92910.1"
FT                   /translation="MFQASAFDPEQPGFNPVHFERAAQRAVVDLQRVAGGPAQRALGLR
FT                   RRTHPAAVRTMSWQALLNVEELAFSNPGFLNRNDPAVVDAFIRLRGSRLVAADVEEPVD
FT                   WRRDDDDLPAIYLIVKAMLEAEEEERAEAA"
     atgttccagg cttccgcatt cgatcccgag caacccggtt tcaatcccgt ccacttcgag        60
     cgcgccgcgc agcgggcggt cgtcgatctg cagcgtgtcg cgggcggccc cgcgcagcgg       120
     gcgctcggtc tgcgccgccg cacccacccg gcggccgtgc gcacgatgag ctggcaggcg       180
     ctgctgaacg tcgaggagct ggcgttctcg aatcccggct tcctgaaccg caacgatccg       240
     gccgtcgtcg acgcattcat ccggctgcgt ggcagccggc tggttgccgc agacgtcgag       300
     gagccggtcg actggcgccg cgacgatgat gacctgccgg ccatctacct gatcgtcaag       360
     gcgatgctcg aagcggaaga ggaagagcgg gccgaagcgg cctga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page